Details for Arabidopsis Locus AT3G20790

Position : Chr3 ( 5`- 7268752 .. 7271287 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20790

Protein [Map View]
MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLVDLKAIWSRTEESAKGAVEIARKHFPEVKCKWGDEGLNEIIQDSSIVG
VAVVVAAETMVELSLKMLKAGKHVLQEKPAAASISEIETAMSSYRNISADSPCRPIWAVAENYRFEPAFVELKKLIAEIG
DMMNVQLIIEGSMNSSNPYFSSSWRRNLSGGFILDMGVHYIAGLRMLVGCEVTSVSATTTHVDKTLPGPDNITSNFQLEN
GCSGVFVMVVSSRSPKILWRIVGLKGTVQLERGVEGGRHGYMATIYGEGGTSRTIFYPFSGVTEELKAFFNDISETSKEQ
EPRLSYVEGARDVAVLEAMLESGAKNGAVVPVNKF*

DNA
ATGGTGAATCCTTCTTCACCTGGAATTGCCATACTCGGAGCTGGGATCTTCGTCAAAACTCAATACATTCCGAGATTAGC
TGAGATCTCCGATCTCGTCGACCTGAAAGCGATTTGGAGCCGTACTGAGGAATCTGCAAAAGGAGCTGTGGAGATAGCAA
GAAAGCATTTTCCTGAAGTGAAGTGCAAATGGGGAGATGAGGGTCTCAATGAGATCATTCAAGACAGTTCAATAGTTGGT
GTTGCTGTAGTTGTAGCTGCAGAAACCATGGTTGAATTGTCACTGAAGATGCTCAAGGCAGGAAAGCACGTCCTTCAAGA
GAAGCCAGCTGCTGCTTCAATCAGTGAGATAGAAACTGCAATGTCAAGCTATAGAAATATTTCTGCTGATTCCCCATGCC
GTCCAATTTGGGCTGTGGCTGAAAATTATCGTTTTGAGCCAGCTTTTGTTGAGTTGAAGAAACTGATAGCAGAAATTGGA
GATATGATGAACGTCCAGCTTATTATTGAGGGATCAATGAACAGTTCTAATCCTTATTTCTCAAGCTCCTGGAGGCGAAA
TTTGAGTGGTGGTTTCATCTTGGATATGGGTGTACATTACATTGCAGGATTAAGAATGCTTGTTGGATGTGAGGTAACAT
CAGTCTCAGCCACCACTACCCATGTGGATAAGACTTTACCTGGACCAGACAATATAACATCAAACTTTCAGCTCGAGAAC
GGATGCTCTGGGGTTTTTGTTATGGTTGTGTCTTCAAGGTCTCCAAAGATACTATGGAGAATCGTAGGACTAAAGGGCAC
TGTTCAACTAGAGCGTGGAGTGGAAGGTGGCCGACATGGTTACATGGCCACGATTTACGGGGAAGGAGGGACATCAAGGA
CCATCTTTTACCCATTCAGCGGAGTGACTGAAGAGTTAAAAGCGTTCTTCAATGATATTTCAGAAACTTCAAAGGAGCAA
GAGCCTCGTCTATCATATGTGGAAGGTGCTCGTGACGTTGCAGTTCTTGAAGCAATGCTCGAGTCTGGTGCGAAAAATGG
AGCCGTAGTCCCTGTCAACAAATTCTAG