Details for Arabidopsis Locus AT3G20740

Position : Chr3 ( 5`- 7248809 .. 7252452 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20740

Protein [Map View]
MSKITLGNESIVGSLTPSNKKSYKVTNRIQEGKKPLYAVVFNFLDARFFDVFVTAGGNRITLYNCLGDGAISALQSYADE
DKEESFYTVSWACGVNGNPYVAAGGVKGIIRVIDVNSETIHKSLVGHGDSVNEIRTQPLKPQLVITASKDESVRLWNVET
GICILIFAGAGGHRYEVLSVDFHPSDIYRFASCGMDTTIKIWSMKEFWTYVEKSFTWTDDPSKFPTKFVQFPVFTASIHT
NYVDCNRWFGDFILSKSVDNEILLWEPQLKENSPGEGASDVLLRYPVPMCDIWFIKFSCDLHLSSVAIGNQEGKVYVWDL
KSCPPVLITKLSHNQSKSVIRQTAMSVDGSTILACCEDGTIWRWDVITK*

DNA
ATGTCGAAGATAACCTTAGGGAACGAGTCAATAGTTGGGTCTTTGACTCCATCGAATAAGAAATCGTACAAAGTGACGAA
TAGGATTCAGGAAGGGAAGAAACCTTTGTATGCTGTTGTTTTCAACTTCCTTGATGCTCGTTTCTTCGATGTCTTCGTTA
CCGCTGGTGGAAATCGGATTACTCTGTACAATTGTCTCGGAGATGGTGCCATATCAGCATTGCAATCCTATGCTGATGAA
GATAAGGAAGAGTCGTTTTACACGGTAAGTTGGGCGTGTGGCGTTAATGGGAACCCATATGTTGCGGCTGGAGGAGTAAA
AGGTATAATCCGAGTCATTGACGTCAACAGTGAAACGATTCATAAGAGTCTTGTGGGTCATGGAGATTCAGTGAACGAAA
TCAGGACACAACCTTTAAAACCTCAACTTGTGATTACTGCTAGCAAGGATGAATCTGTTCGTTTGTGGAATGTTGAAACT
GGGATATGTATTTTGATATTTGCTGGAGCTGGAGGTCATCGCTATGAAGTTCTAAGTGTGGATTTTCATCCGTCTGATAT
TTACCGCTTTGCTAGTTGTGGTATGGACACCACTATTAAAATATGGTCAATGAAAGAGTTTTGGACGTACGTCGAGAAGT
CATTCACATGGACTGATGATCCATCAAAATTCCCCACAAAATTTGTCCAATTCCCTGTATTTACAGCTTCCATTCATACA
AATTATGTAGATTGTAACCGTTGGTTTGGTGATTTTATCCTCTCAAAGAGTGTGGACAACGAGATCCTGTTGTGGGAACC
ACAACTGAAAGAGAATTCTCCTGGCGAGGGAGCTTCAGATGTTCTATTAAGATACCCGGTTCCAATGTGTGATATTTGGT
TTATCAAGTTTTCTTGTGACCTCCATTTAAGTTCTGTTGCGATAGGTAATCAGGAAGGAAAGGTTTATGTCTGGGATTTG
AAAAGTTGCCCTCCTGTTTTGATTACAAAGTTATCACACAATCAATCAAAGTCTGTAATCAGGCAAACAGCCATGTCTGT
CGATGGAAGCACGATTCTTGCTTGCTGCGAGGACGGGACTATATGGCGCTGGGACGTGATTACCAAGTAG