Details for Arabidopsis Locus AT3G20730

Position : Chr3 ( 5`- 7247095 .. 7249145 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20730

Protein [Map View]
MLVVSENYLLSPSLYLKALKLCSYQNVKKQLLLIHGNSITNGFCSNLQLKDMLIDLYLKQGDVKHARKLFDRISKRDVVS
WTAMISRFSRCGYHPDALLLFKEMHREDVKANQFTYGSVLKSCKDLGCLKEGMQIHGSVEKGNCAGNLIVRSALLSLYAR
CGKMEEARLQFDSMKERDLVSWNAMIDGYTANACADTSFSLFQLMLTEGKKPDCFTFGSLLRASIVVKCLEIVSELHGLA
IKLGFGRSSALIRSLVNAYVKCGSLANAWKLHEGTKKRDLLSCTALITGFSQQNNCTSDAFDIFKDMIRMKTKMDEVVVS
SMLKICTTIASVTIGRQIHGFALKSSQIRFDVALGNSLIDMYAKSGEIEDAVLAFEEMKEKDVRSWTSLIAGYGRHGNFE
KAIDLYNRMEHERIKPNDVTFLSLLSACSHTGQTELGWKIYDTMINKHGIEAREEHLSCIIDMLARSGYLEEAYALIRSK
EGIVSLSSSTWGAFLDACRRHGNVQLSKVAATQLLSMEPRKPVNYINLASVYAANGAWDNALNTRKLMKESGSCNKAPGY
SLVY*

DNA
ATGCTGGTTGTTTCGGAAAACTACTTATTAAGCCCTTCTTTGTACCTTAAAGCTCTTAAATTATGCAGCTACCAAAACGT
CAAGAAACAACTATTGTTGATCCATGGGAATTCGATTACAAATGGGTTCTGCTCCAATCTCCAGTTGAAGGACATGTTGA
TAGATTTGTACTTAAAACAGGGAGATGTGAAACATGCACGTAAACTGTTCGATAGAATTTCTAAGAGAGATGTGGTTTCT
TGGACAGCTATGATCTCGAGGTTTTCTCGATGTGGATATCACCCGGACGCGTTGTTGTTGTTTAAAGAGATGCACCGGGA
AGATGTTAAGGCTAATCAGTTCACTTATGGGAGTGTTTTGAAGTCGTGTAAAGATTTGGGGTGTCTGAAAGAAGGGATGC
AGATACATGGTAGTGTGGAGAAAGGGAATTGTGCAGGGAACTTAATTGTGAGAAGTGCATTGCTTTCTCTTTATGCCAGG
TGTGGAAAGATGGAGGAAGCTCGTCTTCAGTTTGATTCAATGAAAGAAAGGGATTTGGTTTCTTGGAATGCTATGATCGA
TGGATACACCGCCAATGCTTGTGCAGATACTTCGTTTAGTCTGTTTCAGTTGATGCTCACGGAAGGGAAGAAGCCAGACT
GCTTCACCTTTGGAAGCCTCTTGAGAGCTTCTATTGTCGTTAAGTGTCTTGAAATAGTCAGTGAATTACATGGATTAGCG
ATCAAGCTGGGTTTTGGGAGATCAAGTGCACTAATTAGGTCTCTGGTTAATGCATATGTGAAGTGTGGTAGCCTTGCCAA
TGCTTGGAAACTGCACGAGGGCACAAAGAAAAGAGACTTACTATCTTGCACTGCTCTAATTACAGGTTTTTCACAGCAGA
ACAACTGCACAAGTGATGCCTTTGATATCTTCAAAGATATGATACGGATGAAAACAAAGATGGACGAAGTTGTAGTATCC
TCGATGCTTAAAATATGCACCACCATTGCATCTGTAACCATTGGAAGACAGATCCATGGTTTTGCCTTAAAATCTTCCCA
AATCAGATTCGATGTTGCTTTGGGGAATTCGCTGATAGATATGTATGCAAAGTCTGGGGAAATCGAGGATGCAGTCCTGG
CTTTCGAAGAGATGAAAGAGAAAGATGTGAGATCATGGACCTCTTTGATTGCAGGATATGGAAGACATGGGAATTTTGAG
AAAGCAATTGATCTTTATAACAGAATGGAGCATGAAAGGATCAAACCGAATGACGTTACATTTCTTTCTCTCCTCTCTGC
TTGTAGTCATACAGGACAAACCGAACTAGGCTGGAAGATTTACGACACAATGATCAACAAGCACGGAATCGAAGCTCGAG
AAGAGCACTTATCTTGCATCATAGATATGCTTGCGCGCAGTGGCTACTTGGAAGAAGCTTATGCACTGATAAGAAGTAAA
GAGGGTATTGTAAGTCTTAGCTCATCAACATGGGGAGCTTTTCTTGATGCATGCAGGCGCCATGGGAATGTGCAGCTCAG
TAAAGTAGCAGCCACGCAGCTTCTGAGTATGGAACCGAGGAAACCAGTCAATTACATCAATTTGGCCAGTGTGTATGCAG
CTAATGGAGCATGGGACAATGCTTTGAATACTAGAAAGCTTATGAAAGAGAGTGGTTCCTGCAATAAAGCTCCAGGATAC
AGCCTTGTGTATTGA