Details for Arabidopsis Locus AT3G20720

Position : Chr3 ( 5`- 7239908 .. 7247005 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20720

Protein [Map View]
MESILARALEYTLKYWLKSFTRDQFKLQGRTAQLSNLDINGEAIHASMGLPPALSVTTAKVGKLEIMLPYVSNVQTEPIV
VQIDKLDLVLEENPDADVTKGPSSSQSPTASAKSNGYGFADKIADGMTLQVKVVNLLLETGGGANREGGAAWAAPLASIT
IRNLVLYTTNESWKVVNLKEARDFSTNTGFIYLFKKLEWEALSIDLLPHPDMFTEANLARSEEANLRDEDGAKRVFFGGE
RFLEGISGQAYITVQRTALNSPLGLEVQLHIPEAVCPALSEPGLRALLRFLTGMYLCLNRGDVDPKSQQSAEAAGRSLVS
VLVDHVFLCIKDAEFQLELLMQSLLFSRACVSDGESANYLTKILIGGLFLRDAFSRSPCALIQPSMKAAAEDLAIPDFAK
NFCPLIYPLDSGPWQIVQDVPLISLHSLQVKPSPKPPHFFSKTVIQCQPLMVHLQEEACLRISSFLADGIVVNPGDVLPD
NSVNSLLFTLKELDVSVPLDMSNLQDSAIEEDLSVKKSFVGARLHIENLSFAESPTLKVRLLNLEKDPACFCLWPGQPID
ASQKKWTAGASHFSLALETSPNSTQLQSPRGPEMGLWNCVEGKDVSIEVAMVSADGKPLITIPPPGGIVRIGVACEQYIS
RASVEQLFFVLDLYSYFGKVSEKISIVKESKRQNTVSLTGGLLEKVPSDTAVKLALKDLQLKFLESSFTSTQDMPLVQFL
GKDLSVKVTHRTLGGAIAVSSNIYWENIEVDCVDTDVEHEHENSWNGHLVSCNGSTPLRRVFWVVNGRHDEHSGSTLTPF
LDISITHVIPLSEKDMECHSVSIVACISGVRLGGGMSYAEALLHRFGILNHDGGPGEGLSRGLDHLSSGPMSKLFKASIV
DDRKKDGTPGNWNGDGFPHLGRPDDIDVSVELRDWLFALEGREGVGTRILNNEDIGREERCWHTNFRTFRVIAKSTPKNV
DSNGTENQCDAHKYPVDSIIVSVEGLQTVKPQMQKGTDSCNGLSTNGVHENGQMHGGVNIEANIVASEDKSVHDDLLNWV
AESLKFSVKQPVEAVVTKDELQHLTFLCKSEIDAMGRIVAGVLRVLKLEESIGQATLNQLSNLGSEGFDKMFSPKASRAG
SPKSSPFAASLDSMREISLRANLESTISSIEEASMELEAKCSALVSDLNDSESSAKHANELKQKLESLQSLMAKLRTQI*

DNA
ATGGAGTCGATACTTGCTCGAGCCTTGGAGTATACACTCAAGTATTGGCTCAAATCGTTTACCAGAGATCAATTTAAGCT
TCAAGGCCGTACCGCTCAGCTTTCTAATTTAGACATCAATGGTGAGGCTATACATGCCAGTATGGGTTTGCCACCAGCTC
TTAGTGTTACCACTGCCAAAGTTGGGAAATTGGAAATCATGCTTCCGTATGTCAGTAATGTACAAACAGAACCCATAGTT
GTGCAAATCGATAAACTTGATCTTGTTCTTGAAGAAAATCCTGATGCCGATGTGACAAAGGGTCCAAGCAGTAGTCAGTC
TCCAACCGCCTCTGCAAAAAGTAATGGTTATGGATTCGCCGACAAGATTGCAGATGGAATGACTTTACAAGTTAAGGTGG
TCAATCTTCTTCTTGAAACTGGAGGTGGTGCCAACCGTGAAGGAGGGGCAGCCTGGGCTGCTCCGCTGGCATCTATTACA
ATTCGTAACCTTGTTCTGTACACCACTAATGAGAGTTGGAAGGTTGTAAATCTGAAAGAAGCAAGGGACTTCTCTACTAA
CACAGGATTTATTTATTTGTTTAAGAAACTTGAATGGGAAGCTTTATCAATTGATCTTCTACCACATCCTGATATGTTCA
CTGAAGCTAATTTAGCCCGGTCTGAAGAAGCAAATCTCAGAGATGAGGATGGTGCAAAACGAGTATTCTTTGGCGGAGAA
CGCTTTTTAGAAGGAATTTCTGGCCAAGCATATATCACGGTTCAGAGAACAGCACTAAACAGTCCACTTGGGCTTGAAGT
CCAGTTGCACATTCCAGAAGCTGTTTGTCCAGCCTTAAGTGAACCAGGGTTGCGTGCTCTTCTCCGCTTTCTAACTGGAA
TGTACTTATGCCTAAACCGAGGAGATGTGGATCCAAAATCTCAGCAGTCTGCTGAAGCAGCTGGACGTTCTCTTGTCTCC
GTTCTTGTGGATCATGTATTTCTTTGCATTAAAGATGCTGAATTCCAACTGGAACTGCTGATGCAATCACTCCTTTTTTC
TCGGGCCTGTGTTTCAGACGGAGAATCAGCTAACTATTTAACTAAGATTTTGATTGGTGGGCTATTTTTAAGGGATGCTT
TTTCGCGCTCTCCTTGTGCTCTAATCCAACCATCCATGAAAGCTGCTGCCGAAGACCTTGCAATTCCCGACTTTGCCAAG
AACTTTTGCCCTCTCATATATCCATTGGACAGCGGCCCGTGGCAAATAGTTCAGGATGTACCCTTGATCTCCCTACACTC
TCTTCAGGTCAAGCCATCCCCAAAACCCCCACACTTTTTCTCAAAGACAGTTATCCAGTGCCAACCCCTCATGGTTCATC
TTCAGGAAGAAGCTTGTTTAAGAATTTCTTCTTTTCTGGCTGATGGCATTGTTGTAAATCCTGGTGATGTTTTACCTGAT
AACTCTGTTAACTCTCTTCTTTTCACCCTCAAAGAGTTAGATGTCTCTGTTCCATTAGACATGAGTAATTTGCAAGATTC
AGCAATTGAAGAAGACCTATCCGTAAAAAAGTCCTTCGTTGGAGCGAGGCTTCATATTGAAAACTTGTCTTTTGCGGAGT
CACCTACCCTAAAAGTTCGGCTACTAAACCTGGAGAAGGATCCTGCTTGCTTCTGTCTTTGGCCAGGACAGCCTATTGAC
GCCAGCCAAAAGAAATGGACAGCCGGAGCCTCACATTTTAGTTTGGCTTTAGAAACATCTCCCAACTCAACTCAACTTCA
GAGTCCTCGTGGTCCGGAAATGGGTTTGTGGAATTGTGTTGAAGGAAAAGACGTGTCTATAGAAGTTGCTATGGTATCTG
CGGATGGAAAACCTCTGATAACAATTCCCCCTCCTGGTGGTATTGTTCGCATAGGAGTTGCTTGTGAGCAATATATTTCA
CGTGCTTCAGTGGAGCAGTTATTTTTTGTTCTGGACCTCTATTCTTACTTTGGTAAGGTGAGTGAAAAGATTTCAATTGT
TAAAGAAAGCAAACGCCAGAATACTGTTTCTTTGACTGGAGGGTTGTTGGAGAAGGTTCCTAGTGATACTGCTGTAAAAT
TGGCTTTGAAGGATCTGCAGCTTAAGTTTCTTGAGTCCTCGTTTACTAGTACCCAGGACATGCCACTCGTTCAGTTTCTT
GGCAAAGATCTTTCTGTGAAGGTAACACATAGAACCCTTGGCGGCGCTATTGCAGTATCATCCAACATATACTGGGAAAA
TATTGAGGTAGATTGTGTAGATACCGACGTAGAACATGAACATGAGAATAGCTGGAACGGTCACTTAGTTAGCTGTAATG
GGTCTACCCCACTGAGGCGTGTCTTTTGGGTTGTCAACGGAAGACATGATGAGCATAGTGGCAGCACTCTTACACCTTTT
CTGGACATAAGCATAACACATGTGATTCCCCTCAGTGAAAAGGATATGGAGTGCCACAGTGTAAGCATCGTGGCTTGTAT
TTCAGGTGTACGCCTAGGAGGAGGAATGAGCTATGCTGAAGCTCTCTTACACCGATTCGGAATTCTGAATCATGATGGTG
GTCCAGGAGAGGGTCTGTCTAGAGGATTAGATCATTTATCTTCTGGACCTATGTCAAAACTTTTCAAAGCATCTATAGTT
GATGACAGGAAAAAGGATGGAACTCCAGGAAACTGGAATGGCGATGGTTTCCCACATTTGGGAAGGCCAGATGACATTGA
TGTCTCTGTTGAGTTAAGAGATTGGTTGTTTGCTTTGGAGGGCAGAGAAGGTGTTGGCACAAGAATTTTGAATAATGAAG
ATATTGGAAGAGAAGAGAGGTGTTGGCACACAAATTTCCGTACTTTCCGAGTAATAGCCAAGAGTACACCAAAGAACGTG
GATTCAAATGGGACAGAAAACCAGTGTGATGCTCACAAGTATCCTGTGGACTCAATTATTGTCAGTGTCGAAGGTCTACA
GACAGTGAAGCCTCAAATGCAGAAAGGGACCGATTCTTGTAATGGTTTGTCTACAAATGGAGTTCACGAAAACGGTCAAA
TGCATGGAGGGGTGAACATTGAAGCTAATATTGTGGCATCTGAAGACAAATCTGTTCATGATGACTTATTGAACTGGGTG
GCAGAAAGTCTGAAATTCTCTGTTAAGCAACCTGTTGAGGCAGTTGTAACAAAGGATGAGCTGCAACATTTGACTTTCTT
GTGCAAATCTGAAATTGACGCAATGGGAAGGATAGTCGCAGGGGTTTTACGTGTACTGAAGCTTGAAGAATCTATTGGCC
AGGCGACTCTTAATCAATTAAGCAACCTTGGAAGTGAAGGTTTTGACAAGATGTTCTCTCCAAAAGCAAGCAGAGCAGGA
AGTCCAAAAAGCTCACCTTTTGCTGCATCATTAGATTCAATGAGAGAAATTTCTTTACGTGCAAACCTCGAATCTACCAT
TTCGTCCATCGAAGAAGCCTCAATGGAGTTAGAGGCCAAGTGTTCAGCTCTAGTGTCTGATCTCAACGATTCAGAATCTT
CAGCAAAACACGCCAACGAGCTCAAGCAGAAACTCGAGAGCTTGCAGAGCTTAATGGCTAAATTACGAACCCAAATCTAA