Details for Arabidopsis Locus AT3G20700

Position : Chr3 ( 5`- 7233525 .. 7234505 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20700

Protein [Map View]
MRSTCKKWYVLTKDQRFAKKRGKEFLMIMNRRVYLIGVNLHNNIDLSIKCRGRLISRDETAQGFYVSQVFHCNGLLLSVS
GKTIDDTRLVVCNPYGVKPKWINPKDNYGRLDIFSLGFDKLCGSYKILRIYDFDNKLQIYDLSSNSWMIPRDTLGRDIEY
MQNGVSSKENTYWCARDKQSQYCFLFCFDFTRERFGPRLPLPFNGAYVSLSAVKEEQLAVLFQPSDKSEIEIWVTNKIEP
EEVSWSVFLKVEMKLRVLSWNFLIDKEKKFAVVFDKDKAKGFKTNYDIAYVIGENGYYRRVDLRESPNKPLCRIVSCYVP
SCVQIE*

DNA
ATGCGATCTACTTGCAAAAAGTGGTACGTTTTAACCAAAGATCAGAGGTTTGCAAAAAAACGGGGAAAAGAGTTTCTAAT
GATAATGAATCGTAGGGTATATTTGATTGGCGTCAATCTCCACAACAACATTGATCTATCTATAAAGTGTAGAGGTAGAC
TTATTAGCAGAGACGAAACAGCTCAGGGATTCTATGTGTCTCAAGTCTTTCACTGCAATGGTTTATTGTTATCCGTATCA
GGAAAAACTATTGATGACACTAGGCTTGTGGTTTGTAACCCGTATGGGGTAAAACCAAAATGGATCAATCCCAAAGATAA
TTACGGGAGATTAGACATATTTTCTCTCGGATTTGACAAATTATGCGGTAGCTACAAAATCTTGAGGATTTACGATTTCG
ATAATAAACTCCAAATCTACGATTTGAGCTCTAATTCATGGATGATTCCAAGAGACACTCTTGGACGGGATATAGAGTAT
ATGCAAAATGGCGTGTCTTCCAAGGAAAATACTTATTGGTGTGCTAGAGATAAACAATCACAATATTGTTTTTTGTTCTG
TTTTGATTTTACAAGGGAGAGATTCGGACCGCGTCTACCACTGCCCTTCAATGGAGCTTATGTGTCTCTATCTGCGGTTA
AAGAAGAGCAGCTTGCAGTGTTATTTCAGCCATCGGATAAATCTGAGATAGAGATTTGGGTTACGAACAAGATTGAGCCT
GAAGAAGTGTCGTGGAGCGTCTTCTTGAAAGTTGAAATGAAACTACGTGTTCTGTCTTGGAATTTCTTGATTGACAAGGA
AAAGAAATTCGCAGTTGTTTTTGATAAAGACAAGGCAAAGGGGTTTAAAACCAATTACGACATAGCTTACGTCATTGGAG
AAAATGGTTATTACAGAAGAGTGGATCTCCGTGAATCTCCAAACAAACCACTTTGCCGTATTGTGTCTTGTTATGTTCCA
AGTTGTGTGCAAATCGAGTAA