Details for Arabidopsis Locus AT3G20680

Position : Chr3 ( 5`- 7230068 .. 7231194 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20680

Protein [Map View]
MASSTLFKLNSQTFKALNPSPPSLSPPNSRIFHLHFSKSLSQQHSKLNHKSTTTRLFAPLCSSLPSPSSSSPPLSKEEAI
NQAKTCLLSCLIKPLNNPKLASPKLRKLKQPRFRLEIPILDDDSPSSLSQLAFSIFHDLPISRRGSNVKLLFLWPNPSFI
DPAVKAFRSDSIHHIAMSPVSDSLKTALRSADVAIFMAPEKSQLEDVKTASEAFSTKPVVMINPRWLFEEEKSFGDGFIG
SFEVIYAFTGLEVRGVFSKRKGVIFKCVRDGVVSGERWNVLVEEEEGNGTLKVVSQFNSRPSIEEVELVLYNLMAMNSPI
TKSAKFLSDLVSNITGKK*

DNA
ATGGCTTCTTCGACTCTCTTCAAACTCAATTCACAGACATTCAAAGCTCTAAACCCATCTCCTCCTTCGTTATCTCCTCC
CAATTCCAGAATTTTCCATCTTCATTTCTCCAAATCACTCTCACAACAGCATTCAAAGCTCAACCACAAATCAACCACTA
CTCGTTTATTCGCTCCTCTCTGTTCCTCTCTTCCTTCACCTTCTTCTTCTTCTCCTCCCCTTTCCAAAGAAGAAGCCATT
AATCAAGCCAAAACTTGTCTCCTTTCATGTCTCATCAAACCCTTAAACAACCCAAAACTCGCTTCCCCAAAACTCAGGAA
GCTCAAACAACCAAGATTCCGTCTTGAAATCCCAATCCTTGACGATGATTCTCCTTCGTCACTCTCTCAGCTCGCTTTCT
CGATCTTTCATGACTTACCCATCTCGAGAAGAGGCTCTAATGTCAAGCTTCTCTTCCTCTGGCCTAACCCTTCATTCATC
GATCCCGCCGTTAAAGCTTTCCGGTCAGACTCTATCCACCACATTGCCATGTCTCCGGTCTCAGACTCTCTTAAAACAGC
TCTGAGATCTGCTGACGTGGCGATCTTCATGGCTCCGGAGAAATCGCAGCTGGAGGATGTTAAGACCGCGAGTGAAGCTT
TTTCTACAAAACCTGTAGTAATGATCAATCCGAGATGGTTGTTTGAAGAAGAGAAAAGCTTTGGAGATGGCTTTATTGGT
TCCTTTGAAGTGATTTATGCGTTCACTGGCTTAGAAGTGAGAGGAGTGTTTAGTAAGAGAAAAGGAGTGATCTTTAAGTG
TGTAAGAGACGGTGTTGTGAGTGGAGAAAGATGGAATGTTCTCGTTGAAGAAGAAGAAGGTAATGGTACTTTGAAAGTTG
TTTCACAATTCAATTCTCGACCATCAATCGAAGAAGTTGAGCTTGTTCTGTATAACTTGATGGCTATGAATTCTCCTATT
ACCAAATCAGCTAAGTTTCTTAGTGATTTGGTTTCAAATATCACTGGGAAGAAGTAG