Details for Arabidopsis Locus AT3G20650

Position : Chr3 ( 5`- 7220799 .. 7224090 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20650

Protein [Map View]
MKRGFSDSPSSSAPPPSSRFKSNPEGDSQFLEDETTKNFARKVADHYSRRTNQTLEEREASPIIHLKKLNNWIKSVLIQL
YARPDDAVLDLACGKGGDLIKWDKARIGYYVGIDIAEGSIEDCRTRYNGDADHHQRRKKFSFPSRLLCGDCFEVELDKIL
EEDAPFDICSCQFAMHYSWTTEARARRALANVSALLRPGGVFIGTMPDANVIIKKLREAEGLEIGNSVYWIRFGEEYSQK
KFKSSSPFGIEYVFHLEDAVDCPEWIVPFNVFKSLAEEYDLELVFVKNSHEFVHEYMKKPEFVELMRRLGALGDGSNDQS
TLSADEWEAAYLYLSFVLRKRGESDGARRSGRRKNGKMNLSKDDVLYIDS*

DNA
ATGAAACGAGGATTCTCCGATTCTCCTTCAAGCTCTGCTCCTCCTCCTTCTTCCAGATTCAAATCTAATCCCGAAGGTGA
TTCTCAGTTTCTGGAAGATGAGACTACAAAGAATTTTGCCCGGAAAGTTGCTGATCATTACAGTAGGAGAACAAACCAAA
CATTGGAAGAGCGAGAAGCTAGTCCCATCATTCATTTGAAGAAACTTAACAATTGGATTAAAAGTGTTTTGATCCAGCTT
TATGCTCGTCCTGACGATGCTGTTCTCGACCTTGCCTGTGGGAAGGGTGGTGATTTGATCAAGTGGGATAAGGCGAGAAT
CGGGTACTATGTTGGAATTGATATTGCTGAAGGGTCGATTGAAGATTGTCGCACGCGTTATAACGGTGATGCAGACCATC
ATCAACGGCGTAAAAAGTTCAGTTTTCCGTCTCGATTATTATGTGGGGATTGTTTTGAGGTAGAGCTAGACAAGATTCTT
GAAGAGGATGCCCCTTTTGATATCTGCAGTTGCCAGTTTGCTATGCATTACTCATGGACTACTGAGGCACGTGCACGACG
AGCTTTGGCAAATGTTTCAGCTTTACTTCGTCCAGGAGGTGTCTTTATCGGAACAATGCCAGATGCCAATGTTATTATAA
AAAAACTCAGAGAAGCTGAAGGTTTGGAGATTGGTAATAGTGTTTACTGGATTCGTTTTGGTGAAGAGTATTCCCAAAAG
AAGTTCAAATCTAGCAGCCCATTTGGTATCGAATACGTGTTTCATCTCGAGGATGCTGTTGATTGTCCTGAATGGATTGT
GCCCTTTAACGTCTTCAAGTCTTTAGCGGAGGAGTATGATTTAGAGTTGGTATTTGTGAAGAACTCCCACGAGTTTGTCC
ATGAGTATATGAAAAAGCCAGAGTTTGTCGAACTCATGAGAAGGCTTGGTGCTTTGGGTGATGGTAGCAATGATCAGAGC
ACATTATCAGCTGATGAATGGGAAGCTGCATATTTATACCTCTCTTTTGTCTTGAGAAAGAGGGGAGAATCAGATGGAGC
TCGAAGGAGCGGGCGGAGGAAGAATGGGAAAATGAACTTGTCGAAAGATGATGTTTTGTATATCGATAGCTGA