Details for Arabidopsis Locus AT3G20640

Position : Chr3 ( 5`- 7210407 .. 7213299 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20640

Protein [Map View]
MGDHHDFINSGSWWKVSSSSSPSSSSSMRASSIESGGSAVFHDKLHHHSLATDHHLQMIGLGLSSQSPVDQWNQSLLRGD
SKAETSFGVMLQENLNLDATSNANANTTSSTSSYQLQESDSSHHHQALWRDPQSDFKPQILTSGGNRGFFLDHQFSPHGS
SSTDSSTVTCQGFAVDNSSNAMYAATTTTPNSSSGMFHHQQAGGFGSSDQQPSRNHQQSSLGYSQFGSSTGNYDQMASAL
PSTWFLRSSPPPKPHSPLRFSNNATFWNPAAAGNAGAPPPHDASSNFFPALQPPQIHPQSFDEQPKNISEIRDSSSNEVK
RGGNDHQPAAKRAKSEAASPSPAFKRKEKMGDRIAALQQLVSPFGKTDAASVLSEAIEYIKFLHQQVSALSNPYMKSGAS
LQHQQSDHSTELEVSEEPDLRSRGLCLVPVSSTFPVTHDTTVDFWTPTFGGTFR*

DNA
ATGGGAGATCATCATGATTTCATCAACTCAGGAAGCTGGTGGAAAGTATCTTCTTCTTCTTCACCATCTTCTTCTTCTTC
CATGAGAGCAAGCTCTATTGAATCTGGTGGTTCTGCTGTTTTCCATGATAAGCTTCATCATCATTCTTTAGCTACTGATC
ACCATCTTCAGATGATTGGTTTAGGACTTTCTTCACAATCACCTGTTGATCAATGGAACCAATCTCTCTTACGAGGAGAT
AGTAAAGCGGAGACAAGCTTTGGTGTGATGCTTCAAGAGAATCTCAATTTAGATGCCACTTCAAACGCAAACGCTAACAC
AACGTCATCCACATCTTCTTACCAGCTGCAAGAATCTGATTCCTCTCACCATCATCAAGCTTTGTGGCGAGATCCACAAA
GCGATTTCAAACCGCAGATTTTAACGAGTGGTGGTAATCGCGGGTTTTTCTTAGATCATCAGTTCAGTCCTCATGGTAGC
TCAAGTACCGACAGTAGCACAGTAACATGTCAAGGTTTCGCTGTTGACAACTCGTCAAACGCCATGTACGCAGCAACAAC
AACAACTCCTAATTCATCTTCCGGTATGTTTCATCATCAGCAAGCAGGTGGTTTTGGCTCTTCTGATCAACAACCGTCGA
GGAATCATCAACAGTCATCTCTTGGCTATTCTCAGTTTGGATCATCCACCGGAAACTATGATCAAATGGCGTCAGCGTTA
CCATCGACTTGGTTTTTAAGATCTTCTCCGCCGCCAAAACCACACAGTCCTTTGAGATTCTCTAATAACGCAACGTTTTG
GAACCCCGCGGCTGCGGGAAACGCCGGTGCTCCTCCTCCTCATGACGCGTCTTCTAACTTTTTCCCGGCGTTACAACCGC
CGCAGATTCATCCGCAGAGTTTTGACGAACAACCAAAGAATATATCGGAGATTAGAGATTCAAGTAGCAACGAAGTAAAG
AGAGGAGGAAACGATCATCAGCCGGCGGCGAAAAGAGCTAAGAGCGAAGCAGCGTCTCCGTCACCAGCTTTCAAGAGGAA
AGAGAAAATGGGGGACAGAATCGCTGCGCTCCAACAATTGGTTTCACCTTTCGGAAAGACTGATGCAGCCTCAGTGCTCT
CTGAAGCCATTGAATACATTAAGTTCTTACACCAACAAGTTTCTGCTCTGAGCAACCCATACATGAAAAGTGGAGCTTCT
TTACAACATCAACAGAGTGATCATTCCACAGAGCTAGAAGTATCAGAAGAACCAGATCTTAGAAGTCGAGGTTTATGCTT
AGTGCCAGTTTCAAGCACATTTCCAGTGACACACGATACTACAGTAGATTTCTGGACTCCTACATTTGGTGGGACTTTTA
GATAG