Details for Arabidopsis Locus AT3G20630

Position : Chr3 ( 5`- 7202773 .. 7208402 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20630

Protein [Map View]
MELLRSNLSRVQIPEPTHRIYKHECCISFDTPRSEGGLFVDMNSFLAFGKDYVSWNYEKTGNPVYLHIKQTRKSIPEDRP
LKKPTLLAIGVDGGFDNNEPEYEESYSIVILPDFVSLPFPSVELPEKVRIAVDTVVNAVGAERKEQVAAWTAEKKLISEH
ALTLQQIKSGIVIPPSGWKCSKCDKTENLWLNLTDGMILCGRKNWDGTGGNNHAVEHYKETAYPLAVKLGTITADLEAAD
VYSYPEDDSVLDPLLAEHLAHFGIDFSSMQKTEMTTAERELDQNTNFDWNRIQESGKELVPVFGPGYTGLVNLGNSCYLA
ATMQIVFSTHSFISRYFSHQSLKMAFEMAPADPTLDLNMQLTKLGHGLLSGKYSMPATQKDATTGDPRQEGIPPRMFKNV
IAASHAEFSSMRQQDALDFFLHLVGKVERASNTTPDLDPSRSFKFGIEEKILCPSGKVGYNKREDCILSLNIPLHEATNK
DELEAFHKQKAGKGLEENDMRSSDEIVRPRVPLEACLANFASSEPIEDYYSSALKGMTTAIKTTGLTSFPDYLVLHMRKF
VMEEGWVPKKLDVYIDVPDVIDISHMRSKGLQPGEELLPDGVPEEVMESAQPVANEEIVAQLVSMGFSQLHCQKAAINTS
NAGVEEAMNWLLSHMDDPDIDAPISHQTSDIDQSSVDTLLSFGFAEDVARKALKASGGDIEKATDWVFNNPNASVSDMDV
SSSNSAQTPAQSGLPDGGGKYKLFGIVSHMGTSVHCGHYVAHILKEGRWVIFNDDKVGISTDPPKDMGYVYFFQRLD*

DNA
ATGGAGCTCCTCCGATCCAACTTGTCTAGGGTTCAGATCCCTGAACCTACTCATCGCATCTACAAGCATGAGTGTTGCAT
CTCCTTCGATACTCCGAGATCCGAAGGAGGATTGTTCGTTGATATGAATAGTTTTCTTGCTTTCGGGAAGGATTATGTTT
CTTGGAACTATGAGAAGACTGGAAACCCTGTTTATCTTCATATTAAGCAGACTAGGAAGTCTATTCCCGAGGATCGGCCT
CTCAAGAAACCGACTCTGCTCGCTATAGGTGTTGATGGAGGCTTTGATAACAATGAGCCAGAGTACGAGGAGTCTTATAG
CATAGTCATACTTCCGGATTTTGTTTCACTCCCGTTTCCTTCTGTTGAGCTACCAGAGAAGGTGAGGATTGCTGTCGATA
CTGTAGTGAATGCCGTTGGTGCTGAGCGGAAAGAGCAAGTTGCAGCTTGGACAGCTGAGAAAAAGTTAATTAGTGAACAT
GCATTGACACTGCAGCAAATCAAGAGTGGCATTGTCATTCCTCCCTCTGGTTGGAAATGTTCTAAGTGTGATAAGACGGA
GAATCTCTGGCTTAATCTTACCGATGGAATGATTCTCTGTGGAAGAAAAAACTGGGATGGAACTGGTGGAAACAACCATG
CTGTTGAGCACTACAAAGAGACAGCCTACCCTCTTGCTGTAAAGCTTGGAACTATCACTGCTGACTTAGAAGCAGCAGAT
GTTTATTCCTATCCGGAAGATGACAGTGTTTTGGACCCGCTCCTGGCTGAGCATCTGGCCCATTTTGGAATTGACTTCTC
GTCGATGCAGAAGACTGAAATGACAACTGCTGAAAGAGAACTTGATCAAAATACAAATTTTGATTGGAACCGTATACAAG
AGAGTGGAAAAGAATTGGTGCCAGTTTTTGGACCTGGATATACCGGACTTGTCAATCTTGGGAACAGTTGCTACTTGGCA
GCTACGATGCAGATTGTTTTCTCTACCCATTCATTTATTTCAAGATACTTTTCACATCAGAGCTTAAAGATGGCTTTTGA
GATGGCTCCTGCTGATCCAACTTTGGACCTCAATATGCAATTAACAAAGCTTGGACACGGCTTACTATCTGGGAAGTACT
CAATGCCTGCAACTCAGAAGGATGCTACAACTGGAGATCCTAGACAAGAAGGAATACCTCCTCGCATGTTCAAAAACGTA
ATTGCCGCGAGCCACGCAGAATTCTCTTCTATGAGACAGCAGGATGCTCTCGACTTTTTCCTCCATCTGGTAGGCAAGGT
TGAGCGTGCTAGCAACACGACACCAGATTTAGACCCCTCGAGGAGCTTCAAGTTTGGAATAGAAGAGAAGATCCTTTGTC
CGTCTGGAAAGGTTGGATATAATAAGAGGGAAGACTGTATTCTTTCTTTGAACATTCCGCTACATGAGGCAACTAATAAA
GATGAATTAGAAGCCTTTCACAAGCAAAAAGCAGGAAAAGGATTGGAAGAGAATGATATGAGGTCAAGTGATGAAATAGT
ACGCCCACGAGTTCCTTTAGAAGCCTGTCTAGCAAATTTTGCATCATCAGAGCCGATTGAAGACTACTATAGCTCTGCTT
TGAAGGGAATGACAACAGCTATCAAGACAACTGGTTTGACATCTTTCCCAGATTATTTGGTCTTGCACATGCGGAAATTT
GTTATGGAGGAAGGCTGGGTGCCAAAGAAACTTGATGTATACATTGATGTTCCGGATGTTATTGATATCAGCCACATGCG
TAGCAAAGGACTCCAACCTGGGGAAGAACTGTTGCCAGATGGCGTTCCAGAAGAAGTGATGGAATCAGCGCAGCCCGTGG
CAAATGAGGAGATAGTTGCACAGCTAGTCTCAATGGGATTTAGCCAGCTTCACTGCCAGAAAGCTGCCATAAATACTTCC
AATGCTGGGGTTGAAGAGGCAATGAACTGGTTACTTTCTCACATGGATGATCCAGACATCGATGCACCAATCTCCCACCA
GACATCTGACATTGATCAATCAAGCGTTGATACCTTACTCTCCTTTGGTTTTGCTGAAGATGTTGCTCGGAAGGCACTAA
AAGCCTCGGGAGGAGACATTGAGAAAGCAACAGACTGGGTATTCAACAACCCTAATGCATCTGTTTCAGACATGGATGTA
TCCTCTAGCAATTCAGCGCAGACTCCGGCTCAAAGTGGATTACCAGATGGAGGAGGGAAATACAAGCTGTTTGGAATAGT
AAGTCACATGGGAACATCAGTGCACTGTGGTCATTACGTGGCTCACATATTGAAAGAAGGCCGCTGGGTAATTTTCAATG
ACGACAAAGTTGGTATCTCGACTGATCCTCCTAAAGACATGGGTTATGTCTACTTCTTTCAGCGGCTTGATTGA