Details for Arabidopsis Locus AT3G20590

Position : Chr3 ( 5`- 7191686 .. 7192453 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20590

Protein [Map View]
MTKIDPEEELGRKCCTCFFKFIFTTRLGALILWLSLRAKKPKCSIQNFYIPALSKNLSSRDNTTLNFMVRCDNPNKDKGI
YYDDVHLTFSTINTTTTNSSDLVLVANYTVPKFYQGHKKKAKKWGQVWPLNNQTVLRAVLPNGSAVFRLDLKTHVRFKIV
FWKTKWYRRIKVGADVEVNGDGVKANEKEIKMEKSNFWKTHGYWSEFGFDDDVELTGDGAQKKGSKTKKSDSSLPLRSSF
PIFVLMNLLVFFAIR*

DNA
ATGACAAAAATAGATCCAGAAGAAGAACTTGGTCGAAAATGTTGTACCTGCTTCTTCAAGTTCATCTTCACAACTCGTCT
CGGCGCTCTTATCTTATGGCTTAGTCTCCGTGCCAAGAAACCCAAATGCTCAATCCAAAACTTTTACATTCCTGCCCTCA
GCAAAAACCTAAGCTCACGAGACAATACCACTCTAAATTTCATGGTTCGTTGTGACAATCCGAATAAAGACAAAGGAATC
TACTACGACGATGTCCACCTTACTTTCTCCACCATCAACACGACCACGACCAATTCATCTGATCTTGTCTTAGTCGCTAA
CTACACAGTGCCTAAGTTCTATCAAGGACACAAGAAGAAGGCCAAGAAGTGGGGTCAAGTTTGGCCGCTAAACAACCAGA
CGGTTTTACGAGCTGTTTTGCCTAATGGATCGGCGGTTTTCAGGCTGGATCTCAAGACTCATGTGAGATTCAAGATTGTT
TTTTGGAAAACTAAATGGTATAGGAGAATTAAAGTTGGTGCTGATGTTGAAGTCAACGGTGATGGAGTTAAAGCTAATGA
GAAAGAGATTAAGATGGAGAAATCTAATTTTTGGAAAACTCATGGATATTGGAGTGAATTTGGTTTTGACGATGATGTTG
AACTCACCGGTGATGGAGCTCAAAAGAAAGGAAGTAAGACGAAGAAATCGGATTCTTCTTTACCATTAAGAAGCTCTTTT
CCGATTTTTGTTTTGATGAATTTGCTCGTATTCTTTGCTATTCGTTAA