Details for Arabidopsis Locus AT3G20570

Position : Chr3 ( 5`- 7186522 .. 7187521 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20570

Protein [Map View]
MARNLKSMMLCGFGLLCFLMIVDRAYAREFTVGGATGWTVPSGSQVYSQWAEQSRFQIGDSLLFVYQSNQDSVLQVTRDA
YDSCNTDSPTAKFADGKTSVTLNHSGPYYFISGNKDNCKKNEKLVVIVMADRSGNKNTASSPPSPAPAPSGESAPSPPVS
GTFEMTPAPTPTTSEDTPNSAASSLSFVAALLGAALASTLFLH*

DNA
ATGGCACGAAACCTAAAGAGCATGATGCTTTGTGGGTTTGGTCTCTTGTGTTTTCTTATGATCGTTGACCGAGCCTACGC
TAGAGAGTTTACGGTCGGTGGTGCAACAGGTTGGACCGTCCCTTCTGGTTCTCAAGTGTACAGTCAATGGGCAGAACAGA
GCAGATTCCAAATTGGTGACTCTCTGTTGTTCGTCTACCAATCAAACCAAGATTCAGTGCTCCAAGTCACAAGAGACGCT
TACGACAGCTGCAACACGGACTCACCAACCGCTAAATTCGCCGATGGCAAAACTTCTGTCACGCTGAACCACTCTGGGCC
ATACTATTTCATTAGTGGAAACAAAGACAACTGCAAGAAAAACGAGAAGCTTGTGGTCATCGTCATGGCTGATAGAAGCG
GCAACAAAAACACCGCATCATCACCGCCGTCCCCAGCCCCAGCTCCCTCAGGAGAATCCGCTCCTTCTCCACCTGTCTCG
GGAACCTTTGAGATGACCCCAGCACCGACGCCTACTACTTCTGAAGACACTCCAAACAGCGCAGCTTCTTCCTTATCATT
TGTCGCTGCTCTTCTTGGGGCTGCTCTAGCTTCCACTCTATTCCTACACTAA