Details for Arabidopsis Locus AT3G20560

Position : Chr3 ( 5`- 7182035 .. 7186567 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20560

Protein [Map View]
MVSSTKLKSVDFYRKIPRDLTEASLSGAGLSIVAALFMMFLFGMELSSYLEVNTTTAVIVDKSSDGDFLRIDFNISFPAL
SCEFASVDVSDVLGTNRLNITKTVRKFPIDPHLRSTGAEFHSGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPI
LVVNFNAPWCYWSNRLKPSWEKAANIIKQRYDPEADGRVLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHH
EHESYYGDRDTDSIVKMVEGLVAPIHPETHKVALDGKSNDTVKHLKKGPVTGGCRVEGYVRVKKVPGNLVISAHSGAHSF
DSSQMNMSHVVSHFSFGRMISPRLLTDMKRLLPYLGLSHDRLDGKAFINQHEFGANVTIEHYLQTVKTEVITRRSGQEHS
LIEEYEYTAHSSVAQTYYLPVAKFHFELSPMQILITENPKSFSHFITNLCAIIGGVFTVAGILDSIFHNTVRLVKKVELG
KNI*

DNA
ATGGTTTCCTCCACCAAACTCAAATCCGTTGATTTCTACAGGAAAATTCCGAGAGATTTGACGGAGGCATCTCTATCAGG
CGCTGGGTTATCAATTGTAGCTGCTCTCTTTATGATGTTTTTGTTTGGAATGGAGCTGAGTAGTTATTTGGAAGTTAACA
CTACCACAGCTGTTATAGTTGACAAGAGCAGTGATGGTGACTTCTTACGCATTGATTTCAACATCAGTTTTCCTGCTCTT
TCCTGTGAATTTGCATCCGTTGATGTGAGCGATGTCTTGGGAACGAATAGGTTGAATATAACAAAAACAGTTCGCAAGTT
TCCAATTGATCCACATTTAAGGTCCACCGGCGCAGAATTCCACTCTGGCCTTGCATTACATAACATAAACCATGGAGAAG
AAACTAAGGAAGAGTTTCCTGATGGTGCTATACCATTGACCAGTGCTAGTTTTGAAGCATTATCACATCACTTTCCAATA
TTGGTTGTTAACTTTAATGCACCATGGTGCTACTGGAGTAATCGTCTGAAACCTTCATGGGAGAAAGCAGCTAATATAAT
AAAACAAAGATATGATCCTGAAGCTGATGGCCGTGTTCTTCTAGGAAATGTTGATTGCACGGAAGAACCTGCGCTATGTA
AGAGGAATCACATACAAGGCTATCCATCTATTCGTATTTTCCGCAAAGGCAGTGACCTTAGAGAGGACCATGGACACCAC
GAACATGAATCTTACTATGGAGATCGGGACACAGACAGTATAGTTAAGATGGTGGAGGGACTGGTCGCACCTATCCACCC
GGAGACTCACAAGGTGGCTTTGGATGGAAAATCCAATGATACTGTAAAACATCTTAAAAAGGGACCAGTTACAGGAGGTT
GTAGAGTTGAAGGTTATGTACGTGTAAAGAAGGTTCCAGGAAATCTCGTGATCTCAGCTCATTCAGGAGCTCATTCATTT
GATTCTTCTCAAATGAACATGTCGCATGTTGTTTCTCATTTTTCGTTTGGGAGGATGATTTCTCCTAGGCTGCTGACCGA
TATGAAGCGATTGTTGCCATATCTTGGCCTAAGCCATGACAGGCTGGATGGAAAGGCATTCATAAATCAACATGAGTTTG
GTGCCAATGTCACTATCGAACACTACCTTCAAACAGTCAAAACAGAGGTCATTACAAGAAGATCCGGTCAAGAACATTCA
CTGATAGAGGAATATGAATACACCGCTCACAGCAGCGTGGCTCAGACTTACTACTTACCCGTTGCGAAGTTTCACTTTGA
GCTCTCTCCTATGCAGATCTTAATAACCGAAAACCCGAAGTCCTTCTCACACTTCATCACAAATCTGTGTGCCATTATTG
GTGGTGTTTTCACGGTTGCCGGAATACTAGATTCGATTTTTCACAATACAGTAAGACTGGTAAAAAAGGTCGAACTTGGG
AAAAACATTTGA