Details for Arabidopsis Locus AT3G20557

Position : Chr3 ( 5`- 7180037 .. 7181079 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20557

Protein [Map View]
MENSALSNCVRRTNFSNQQRTMQEGLEESSWTMYFETEDGLGHYDDSSMMSDAASPMGCVEEDTASSPSNRTEGYSGMED
NTIEEKTMNNGKIEEKILNKNGIKIEEYCAELKKRGLCLVPLSMLSNYIG*

DNA
ATGGAAAACTCAGCACTAAGCAACTGTGTGAGGCGAACAAATTTCTCTAATCAACAGAGAACTATGCAAGAGGGTCTAGA
AGAGAGTAGTTGGACAATGTACTTTGAAACAGAAGATGGATTAGGCCATTACGATGATTCTTCAATGATGTCAGACGCTG
CTTCTCCTATGGGTTGTGTCGAAGAAGACACCGCTTCATCTCCTTCTAACAGAACCGAGGGTTACAGTGGAATGGAAGAC
AATACGATAGAAGAAAAAACCATGAACAATGGTAAGATTGAGGAGAAAATATTGAATAAAAATGGGATAAAGATTGAAGA
ATACTGCGCAGAATTGAAGAAGAGAGGACTTTGCTTAGTCCCTTTGTCGATGTTATCTAACTATATTGGTTGA