Details for Arabidopsis Locus AT3G20540

Position : Chr3 ( 5`- 7168132 .. 7173617 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20540

Protein [Map View]
MGVSLRHLSPSSFWVSRRPRVSSSILSFLVPRRRILCTRSRLKMCVCSIALFRKKVAIIKGNAGYSTATDCGGSHGFHHS
GHQRSSSVEFSGEWKLNLGSKTARMVPPTVKQAGAVSAWREEVNNKLRGRNREYANNQDDAFGNGSYILKGFVPKIDDVH
SYGNGQNFDYNLKPGTDITTLGRELNGFMQTNSIRGSVVALPSKDIEVGETTDVTLKPLNSDTTLDNASYKKTATISKVE
KCTNLSQVRANLKKIYNRVRVVDNVSSAKETVALLMNQYRNLVHACDTEVSRIDVKTETPVDHGEMICFSIYCGSEADFG
DGKSCIWVDVLGENGRDILAEFKPFFEDSSIKKVWHNYSFDNHIIRNYGIKLSGFHGDTMHMARLWDSSRRISGGYSLEA
LTSDPKVLGGTETKEEAELFGKISMKKIFGKGKLKKDGSEGKLVIIPPVKELQMEDREAWISYSALDSISTLKLYESMKK
QLQAKKWFLDGKLISKKNMFDFYQEYWQPFGELLAKMESEGMLVDRDYLAQIEIVAKAEQEIAVSRFRNWASKHCPDAKH
MNVGSDTQLRQLFFGGISNSCNDEDLPYEKLFKVPNVDKVIEEGKKRATKFRNIKLHRISDRPLPTEKFTASGWPSVSGD
TLKALAGKVSAEYDYMEGVLDTCLEENIGDDDCISLPDEVVETQHVNTSVESDTSAYGTAFDAFGGGESGKEACHAIAAL
CEVCSIDSLISNFILPLQGSNVSGKDGRVHCSLNINTETGRLSARRPNLQNQPALEKDRYKIRQAFIASPGNSLIVADYG
QLELRILAHLASCESMKEAFIAGGDFHSRTAMNMYPHIREAVENGEVLLEWHPQPGQEKPPVPLLKDAFASERRKAKMLN
FSIAYGKTAIGLSRDWKVSREEAQDTVNLWYNDRQEVRKWQELRKKEAIQKGYVLTLLGRARKFPEYRSRAQKNHIERAA
INTPVQGSAADVAMCAMLEISNNQRLKELGWKLLLQVHDEVILEGPSESAENAKDIVVNCMSEPFNGKNILSVDLSVDAK
CAQNWYAGK*

DNA
ATGGGGGTTTCTCTTCGTCACTTGTCTCCTTCCTCTTTCTGGGTTTCGCGTCGTCCTCGTGTTTCTTCTTCAATTCTTTC
TTTTCTTGTCCCTCGCCGTCGAATCCTTTGCACCAGAAGCAGGTTAAAAATGTGTGTTTGCTCAATTGCTCTGTTTCGTA
AGAAAGTAGCAATCATAAAGGGAAATGCGGGATATTCGACTGCTACTGATTGTGGTGGTTCTCATGGGTTTCATCATTCA
GGTCATCAAAGGTCATCCTCTGTTGAGTTTAGTGGAGAGTGGAAACTTAATTTGGGATCTAAGACGGCGAGAATGGTTCC
GCCAACTGTGAAACAAGCTGGAGCTGTAAGTGCTTGGAGGGAGGAAGTCAATAATAAGTTAAGAGGAAGAAATAGAGAAT
ATGCTAACAACCAGGATGATGCTTTTGGTAATGGCAGTTATATTTTAAAAGGCTTTGTCCCCAAAATAGATGATGTCCAT
TCTTATGGAAACGGCCAGAACTTTGATTACAATCTGAAGCCTGGAACTGATATTACCACACTTGGTAGAGAATTGAATGG
CTTTATGCAAACGAATAGTATAAGAGGATCGGTCGTAGCATTACCAAGCAAGGATATTGAGGTTGGGGAAACAACAGACG
TGACTCTGAAACCTCTTAACAGTGATACGACTCTTGACAATGCCAGCTATAAGAAAACAGCAACCATTTCCAAAGTGGAA
AAATGCACCAACCTATCGCAAGTCCGTGCAAACCTCAAGAAAATATACAATAGAGTTCGTGTTGTTGATAATGTGTCTAG
TGCAAAGGAAACCGTGGCTCTGCTCATGAATCAATATAGGAATCTTGTCCATGCTTGCGATACAGAGGTATCCAGGATTG
ATGTGAAGACTGAAACACCTGTAGACCATGGGGAGATGATTTGTTTCAGTATCTATTGTGGATCAGAAGCAGATTTTGGA
GATGGTAAATCATGTATCTGGGTAGATGTGCTTGGCGAAAATGGAAGGGATATCCTGGCTGAGTTTAAGCCATTTTTCGA
AGACTCATCCATAAAAAAAGTATGGCATAACTACAGCTTTGATAACCACATCATCAGAAATTATGGAATCAAGCTTTCTG
GTTTTCATGGTGATACAATGCACATGGCACGATTGTGGGATTCATCTAGACGGATATCGGGTGGTTATTCGCTTGAAGCA
CTTACAAGTGACCCAAAAGTTCTTGGGGGAACTGAGACAAAGGAGGAAGCAGAATTATTTGGTAAAATATCAATGAAGAA
GATTTTCGGCAAGGGAAAATTGAAAAAAGATGGATCAGAAGGAAAATTGGTGATCATTCCTCCTGTTAAAGAGCTACAAA
TGGAGGATCGAGAAGCTTGGATTTCGTACTCAGCGTTGGATTCAATAAGCACTCTAAAGCTTTATGAGAGCATGAAGAAG
CAACTGCAAGCGAAGAAATGGTTTCTTGATGGAAAACTAATTTCAAAAAAGAACATGTTTGATTTCTACCAAGAATATTG
GCAACCTTTTGGTGAACTTCTTGCCAAAATGGAATCGGAAGGAATGCTTGTAGATAGGGATTATTTGGCGCAGATTGAGA
TTGTAGCCAAAGCAGAACAAGAAATTGCTGTTTCGAGGTTCCGTAATTGGGCTTCAAAGCATTGTCCAGATGCAAAGCAT
ATGAATGTTGGCAGTGACACGCAATTGCGACAACTCTTTTTTGGTGGCATTTCTAACAGTTGTAATGATGAGGATCTTCC
ATATGAAAAACTTTTCAAAGTTCCCAATGTGGATAAGGTGATTGAAGAAGGAAAAAAGAGAGCCACAAAATTCCGGAATA
TCAAACTGCATAGGATAAGCGACAGACCTTTGCCCACTGAAAAGTTCACTGCCTCAGGCTGGCCCTCTGTTAGTGGAGAC
ACCTTGAAAGCCTTAGCTGGGAAAGTCTCTGCAGAATATGACTATATGGAGGGCGTTTTAGATACTTGTCTAGAAGAAAA
CATTGGAGATGATGATTGTATTTCGCTACCAGATGAAGTTGTAGAAACACAACACGTCAATACCTCTGTTGAATCAGACA
CATCTGCTTATGGAACAGCATTTGATGCATTTGGAGGGGGTGAAAGTGGAAAGGAAGCTTGCCATGCTATTGCTGCATTA
TGTGAAGTTTGCTCCATTGATTCCTTAATATCAAATTTTATCCTTCCTTTACAGGGAAGTAACGTGTCAGGAAAAGATGG
TCGTGTCCACTGCTCCCTGAATATCAACACTGAAACTGGACGCTTATCGGCTAGAAGGCCAAATTTGCAGAACCAACCTG
CATTGGAGAAAGATCGGTACAAAATCCGTCAGGCCTTCATAGCATCACCTGGAAATTCACTTATTGTTGCTGATTATGGA
CAGCTGGAACTTAGGATTCTGGCACATCTTGCTAGTTGCGAAAGCATGAAGGAAGCTTTCATAGCTGGTGGAGACTTCCA
CTCAAGAACAGCCATGAATATGTATCCTCATATTCGTGAAGCTGTTGAAAATGGTGAAGTGCTCCTTGAATGGCATCCAC
AACCTGGACAAGAGAAGCCGCCAGTGCCATTGTTGAAGGATGCCTTTGCTTCTGAGAGAAGAAAAGCAAAGATGCTTAAC
TTCTCGATTGCGTATGGGAAGACTGCTATTGGGCTGTCTAGAGATTGGAAGGTATCAAGAGAAGAAGCTCAAGATACAGT
TAATCTCTGGTATAATGACAGACAAGAAGTCCGGAAATGGCAAGAACTACGCAAGAAAGAAGCTATACAAAAAGGGTATG
TACTCACTTTGTTGGGAAGGGCTCGTAAATTCCCTGAATACCGTTCACGTGCCCAAAAGAACCATATCGAGCGAGCAGCA
ATCAACACTCCTGTTCAGGGAAGTGCGGCTGATGTTGCTATGTGCGCTATGCTGGAGATATCAAATAATCAACGGCTAAA
AGAGCTTGGTTGGAAATTGCTTCTACAAGTTCATGATGAAGTAATCTTGGAAGGACCAAGTGAGTCAGCGGAGAACGCTA
AAGACATAGTTGTGAACTGCATGTCTGAACCCTTCAACGGCAAGAATATTCTCTCAGTCGACTTATCTGTTGATGCTAAG
TGTGCTCAGAACTGGTATGCTGGCAAATAA