Details for Arabidopsis Locus AT3G20490

Position : Chr3 ( 5`- 7153539 .. 7156536 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20490

Protein [Map View]
MDSIEPPSFSLGFDLDAASDLQSEIHQNPSSTGDQLIGDGDNEPELGLTVSDSDRELEPDFTSPVLKRLRRGINPNKCSV
KDDRSVAVEDRDDDIEEFSSPEDFPTDAPASTRSHFSSCSSRVPLHGSGVLSNQPSISRGKRKQSDVQASAASGISSVAS
LFQMSSRSPLRRFQLLDSDSEDDHPSTSRDLSGATKKHDSFSKNQPSIASKPKRKEPGSIPCIKDLWKDFSPASSKIQTP
AFDDVCQDYFISIKTTSTAQKQSSAVASSSNSGNHNLTGFQQTELFHDFSHPSPPSHRFFLHSDPRIRNLARQRLPNFFP
LGIVNDRESQREVFLVDYMNQFGSKGSSKAGDSSSKSCRRGKTKSKVSKSQESAHNSEGWLNPKTRAAAPKDAGKRRVSA
DSGSAGHWFTSPEGRKVYISKSGQEFSGQSAYRCYKKENGVGFKKSRKKRQPKKKAKN*

DNA
ATGGATTCGATTGAGCCACCATCGTTTTCGCTAGGGTTTGATCTTGATGCTGCATCGGATCTCCAATCGGAAATCCATCA
AAACCCTAGCTCCACCGGCGACCAATTAATCGGGGACGGCGATAACGAGCCAGAGTTGGGACTTACTGTCTCAGATTCCG
ATCGGGAGCTTGAACCAGATTTTACAAGCCCGGTTCTCAAGCGGTTGCGACGAGGGATTAATCCCAACAAGTGTTCTGTG
AAAGATGATAGAAGCGTAGCTGTAGAGGATCGGGATGATGACATTGAAGAGTTCTCTTCTCCTGAGGATTTTCCTACGGA
CGCACCGGCCTCAACAAGAAGTCATTTTTCTAGTTGCAGCTCAAGGGTGCCACTTCATGGTTCTGGGGTTTTATCTAATC
AACCTTCTATCTCTCGGGGAAAAAGAAAGCAGTCGGATGTTCAAGCATCTGCTGCCTCTGGGATTAGTTCTGTTGCATCG
TTGTTTCAGATGTCAAGTCGTAGTCCTCTACGAAGGTTCCAGCTACTAGATTCAGATTCTGAAGATGACCATCCATCCAC
CAGCAGAGATTTAAGCGGAGCAACTAAAAAACATGATTCATTCTCAAAGAATCAACCATCTATTGCAAGTAAACCGAAGA
GAAAGGAACCTGGATCTATCCCCTGTATTAAAGATCTGTGGAAAGATTTTTCCCCGGCAAGTTCCAAGATTCAGACACCA
GCTTTCGATGATGTTTGTCAGGACTATTTTATCTCCATCAAGACGACTAGCACAGCTCAGAAACAAAGCAGTGCTGTGGC
AAGTAGTAGCAATAGCGGAAATCATAACTTGACTGGCTTTCAGCAAACTGAGCTATTCCACGATTTTTCCCACCCTTCTC
CTCCATCTCATCGTTTCTTCTTGCATAGTGATCCAAGGATCCGGAATCTAGCTCGACAGCGGTTACCAAACTTCTTTCCT
CTGGGAATTGTCAATGATAGGGAGAGCCAGCGAGAGGTGTTCCTTGTTGATTATATGAATCAATTTGGCAGCAAAGGGAG
TTCTAAAGCTGGAGACTCTAGCAGCAAAAGCTGCAGAAGAGGGAAAACAAAGTCAAAGGTTTCAAAGAGCCAAGAGAGCG
CACACAATTCTGAAGGCTGGTTAAATCCTAAAACGAGAGCTGCAGCTCCAAAGGATGCTGGGAAAAGGCGTGTATCTGCT
GACAGTGGCTCTGCAGGTCATTGGTTCACATCCCCAGAAGGAAGAAAGGTATATATCTCTAAAAGCGGACAGGAGTTTTC
AGGTCAAAGTGCTTATAGATGTTACAAAAAGGAGAACGGAGTCGGGTTTAAGAAGTCCAGAAAGAAACGACAACCAAAGA
AAAAGGCGAAGAATTGA