Details for Arabidopsis Locus AT3G20475

Position : Chr3 ( 5`- 7143454 .. 7151014 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20475

Protein [Map View]
MEEMEDTETEPQVYMACIQHGRRVGVSYYDCSVRQLHVLEFWEEDCSDFTLINMVKYQAKPSIIYASTKSEESFVAALQQ
NDGTDETTMVKLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMMDVGSEVQVRVSGGLLAILESERIVETLE
QNESGSASIAIDSVMEVPLNKFLKLDAAAHEALQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPI
LDLEVLDRRLNAISFFISSVELMASLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLHVNKIFEVGVSESL
REHMRRFNLDIIEKAGLCISTELDYVYELVIGVIDVTRSKERGYQTLVKEGFCAELDELRQIYEELPEFLQEVSAMELEH
FPHLHKEKLPPCIVYIQQIGYLMCIFGEKLDETALNRLTEFEFAFSDMDGETQRFFYHTSKTRELDNLLGDIYHKILDME
RAIIRDLLSHTLLFSAHLLKAVNFVAELDCILSLACVAHQNNYVRPVLTVESLLDIRNGRHVLQEMAVDTFIPNDTEIND
NGRIHIITGPNYSGKSIYVKQVALIVFLSHIGSFVPADAATVGLTDRIFCAMGSKFMTAEQSTFMIDLHQVGMMLRQATS
RSLCLLDEFGKGTLTEDGIGLLGGTISHFATCAEPPRVVVCTHLTELLNESCLPVSEKIKFYTMSVLRPDTESANMEEIV
FLYRLIPGQTLLSYGLHCALLAGVPEEVVKRAAIVLDAFESNNNVDKLSLDKISSQDQAFKDAVDKFAELDISKGDIHAF
FQDIFTS*

DNA
ATGGAGGAAATGGAAGACACTGAAACCGAACCACAGGTTTACATGGCTTGTATTCAGCACGGTCGGAGAGTTGGAGTTTC
TTACTACGACTGTAGTGTACGCCAGCTTCATGTGCTAGAATTTTGGGAAGAAGATTGCTCAGATTTTACATTGATCAATA
TGGTAAAATATCAAGCGAAGCCATCGATCATTTACGCAAGCACGAAAAGTGAAGAATCCTTTGTAGCTGCTTTGCAGCAG
AATGACGGAACTGACGAGACTACCATGGTAAAGCTGGTAAAGAGCTCAACATTCAGCTACGAGCAAGCGTGGCACAGACT
GGTATATCTTCGAGTAACTGGAATGGATGATGGATTGAACATCAAAGAAAGGATTTGTTATCTGAGTTCCATGATGGATG
TGGGCAGTGAAGTCCAAGTTCGTGTTAGTGGTGGTCTTCTTGCTATATTAGAAAGCGAACGAATTGTAGAAACCCTGGAA
CAAAACGAATCTGGGAGTGCATCAATCGCAATTGATTCAGTCATGGAAGTACCATTGAACAAGTTTCTTAAACTTGATGC
TGCTGCTCACGAGGCTCTGCAGATATTTCAGACAGATAAACATCCAAGCCATATGGGCATTGGCCGGGCCAAAGAAGGGT
TCTCGGTATTTGGAATGATGAATAAGTGTGCCACGCCAATGGGTAGACGCCTTTTAAGAAGCTGGTTTATGAGACCAATT
TTAGATCTTGAAGTGTTAGATCGCCGTCTCAATGCTATTTCCTTTTTCATTTCTTCAGTAGAGCTGATGGCATCATTGCG
GGAGACACTGAAATCAGTGAAGGACATTTCACATCTACTCAAGAAATTCAACTCTCCGACGTCCCTCTGTACCAGTAACG
ACTGGACAGCTTTCTTGAAGAGCATAAGTGCGCTCCTGCACGTGAATAAGATATTTGAAGTTGGAGTTTCAGAAAGTCTC
AGAGAGCATATGAGACGCTTCAACTTGGACATTATTGAGAAGGCCGGCTTATGTATCAGCACAGAGCTAGATTATGTCTA
TGAACTGGTCATTGGAGTCATTGATGTTACTAGAAGCAAAGAGAGGGGATATCAAACTTTGGTTAAAGAAGGATTCTGTG
CTGAGTTGGATGAGCTCAGGCAAATATATGAGGAGTTGCCAGAATTTCTGCAGGAGGTTTCAGCGATGGAGTTAGAACAC
TTTCCTCATTTGCATAAGGAAAAGCTTCCTCCTTGTATCGTCTATATTCAACAAATTGGGTACCTCATGTGTATCTTTGG
AGAAAAGCTTGATGAAACTGCTCTTAATAGGCTTACTGAATTTGAATTTGCGTTTTCTGATATGGATGGAGAGACTCAGC
GATTCTTTTACCATACCTCGAAGACACGAGAGTTAGACAACCTTCTTGGAGATATCTACCACAAAATTTTAGATATGGAA
AGGGCAATTATTAGGGACTTGCTGTCACACACACTTTTGTTCTCGGCTCACCTGCTGAAGGCAGTTAACTTTGTTGCAGA
ACTTGATTGCATTTTATCGTTGGCTTGTGTAGCCCATCAGAATAACTACGTAAGGCCTGTCCTGACAGTAGAATCATTGC
TTGATATTCGAAATGGAAGGCATGTTTTGCAGGAAATGGCTGTAGATACTTTTATCCCAAACGACACTGAAATCAATGAT
AATGGACGAATTCATATAATTACCGGGCCTAATTACTCAGGAAAGAGCATATATGTAAAGCAGGTGGCGTTAATTGTTTT
CCTATCCCATATTGGAAGCTTTGTACCAGCAGATGCAGCAACTGTTGGTTTAACTGACAGGATCTTTTGTGCAATGGGAA
GCAAGTTCATGACCGCGGAGCAATCTACATTCATGATAGATCTGCATCAAGTAGGAATGATGCTCAGGCAGGCAACTTCA
AGATCTCTGTGTCTCTTAGACGAGTTTGGTAAAGGCACTCTTACAGAAGATGGTATTGGCTTGCTTGGTGGGACAATTAG
TCACTTTGCTACATGTGCTGAGCCACCAAGGGTTGTAGTATGTACGCACTTGACTGAGCTACTTAACGAGAGCTGCTTGC
CTGTTTCTGAGAAGATTAAGTTCTACACAATGAGCGTTCTTAGGCCAGACACAGAATCTGCAAACATGGAAGAGATTGTT
TTTCTTTATAGGTTAATTCCGGGACAAACTTTGCTGAGCTATGGCCTTCACTGTGCGCTACTCGCTGGTGTCCCGGAGGA
AGTCGTGAAGAGAGCAGCCATCGTGTTGGACGCCTTTGAGAGTAACAACAACGTCGATAAACTAAGCCTTGACAAAATAT
CGTCTCAAGATCAAGCATTCAAGGATGCTGTTGACAAGTTTGCGGAGCTTGACATCAGTAAAGGTGACATCCATGCCTTC
TTTCAAGATATCTTCACTTCCTAA