Details for Arabidopsis Locus AT3G20470

Position : Chr3 ( 5`- 7140440 .. 7141228 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20470

Protein [Map View]
MASKSLFLVALLVGSFAFTSFASVANRKLKSGLEDQKTFFHHPGGGLGGGGGIGGGSGLGGGGGFGGGGGLGGGAGGGGG
LGGGAGGGAGGGFGGGAGSGGGLGGGGGAGGGFGGGAGGGSGGGFGGGAGAGGGLGGGGGAGGGGGFGGGGGSGIGGGFG
GGAGAGGGFGGGHH*

DNA
ATGGCTTCCAAGTCACTCTTTCTTGTTGCCTTACTTGTCGGCTCTTTTGCTTTCACTTCATTTGCCAGTGTCGCTAACAG
GAAGCTGAAGAGTGGTCTCGAGGACCAAAAGACATTCTTCCACCATCCAGGCGGAGGTCTCGGTGGAGGAGGCGGTATTG
GTGGAGGCAGTGGTCTTGGTGGAGGAGGCGGCTTTGGTGGAGGAGGCGGTCTTGGCGGAGGAGCTGGAGGCGGTGGCGGT
TTAGGAGGAGGAGCTGGTGGTGGAGCTGGAGGAGGATTTGGTGGAGGAGCTGGGAGCGGTGGTGGTCTTGGTGGGGGTGG
TGGTGCTGGTGGAGGATTTGGCGGTGGGGCTGGTGGTGGTTCAGGTGGAGGGTTTGGAGGAGGAGCTGGTGCTGGGGGTG
GACTCGGAGGAGGAGGTGGAGCTGGTGGCGGTGGTGGGTTTGGAGGAGGAGGCGGAAGCGGTATTGGTGGTGGTTTCGGT
GGGGGAGCCGGTGCCGGAGGTGGTTTCGGTGGTGGACATCATTGA