Details for Arabidopsis Locus AT3G20460

Position : Chr3 ( 5`- 7135050 .. 7139472 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20460

Protein [Map View]
MGDEPLLQKVKIQEDIESVPLLQKVKIQEDIESVKGIRVNNDGEEDGPVTLILLFTTFTALCGTFSYGTAAGFTSPAQTG
IMAGLNLSLAEFSFFGAVLTIGGLVGAAMSGKLADVFGRRGALGVSNSFCMAGWLMIAFSQATWSLDIGRLFLGVAAGVA
SYVVPVYIVEIAPKKVRGTFSAINSLVMCASVAVTYLLGSVISWQKLALISTVPCVFEFVGLFFIPESPRWLSRNGRVKE
SEVSLQRLRGNNTDITKEAAEIKKYMDNLQEFKEDGFFDLFNPRYSRVVTVGIGLLVLQQLGGLSGYTFYLSSIFKKSGF
PNNVGVMMASVVQSVTSVLGIVIVDKYGRRSLLTVATIMMCLGSLITGLSFLFQSYGLLEHYTPISTFMGVLVFLTSITI
GIGGIPWVMISEMTPINIKGSAGTLCNLTSWSSNWFVSYTFNFLFQWSSSGVFFIYTMISGVGILFVMKMVPETRGRSLE
EIQAAITR*

DNA
ATGGGAGACGAACCACTTCTTCAGAAAGTCAAGATTCAAGAAGACATTGAATCCGTACCACTTCTTCAGAAAGTCAAGAT
TCAAGAAGACATTGAATCCGTTAAAGGAATTCGTGTAAATAATGACGGCGAAGAGGACGGTCCCGTTACTTTAATTCTAC
TCTTCACAACCTTCACTGCTCTCTGCGGCACCTTCTCCTATGGCACTGCCGCCGGCTTTACATCACCAGCTCAAACCGGG
ATTATGGCAGGACTGAACCTTTCTTTGGCTGAGTTCTCATTCTTTGGGGCTGTCTTAACAATTGGTGGACTTGTGGGAGC
CGCGATGTCGGGAAAACTTGCTGATGTCTTTGGTCGAAGAGGCGCTTTGGGGGTTTCAAACTCGTTTTGCATGGCCGGCT
GGCTTATGATTGCCTTCTCTCAGGCGACTTGGTCCCTTGATATCGGAAGACTTTTTCTCGGGGTCGCAGCTGGCGTAGCT
TCTTATGTGGTACCAGTCTATATTGTTGAAATCGCTCCCAAAAAAGTTCGTGGCACATTCTCTGCGATTAACTCGCTTGT
GATGTGTGCTAGCGTCGCCGTCACATACCTCCTTGGATCAGTCATTTCATGGCAAAAATTAGCTCTCATAAGTACGGTTC
CTTGTGTTTTTGAATTCGTCGGTTTATTCTTCATACCGGAGTCTCCTAGGTGGCTGTCTAGAAACGGTAGGGTGAAAGAA
TCGGAAGTTTCACTCCAACGCCTACGAGGAAACAACACTGATATCACTAAAGAGGCTGCAGAAATCAAAAAATATATGGA
TAATCTTCAAGAATTCAAAGAAGATGGTTTTTTCGATCTCTTCAACCCACGATATTCTCGTGTCGTTACTGTTGGAATTG
GATTGCTAGTACTACAACAACTGGGAGGTCTCAGTGGCTATACATTTTACCTTAGCTCGATATTCAAAAAATCGGGGTTT
CCTAACAACGTAGGAGTAATGATGGCGAGCGTGGTGCAGTCTGTGACAAGCGTTTTAGGAATAGTAATCGTGGATAAATA
TGGAAGACGATCCCTTTTAACGGTTGCGACGATCATGATGTGTTTGGGCTCATTAATTACAGGACTATCGTTTTTGTTTC
AGAGCTATGGTTTACTTGAACATTACACCCCAATTTCAACATTTATGGGAGTGTTGGTTTTTCTAACTTCGATTACAATC
GGAATAGGAGGTATTCCATGGGTTATGATATCTGAGATGACACCGATCAATATAAAAGGATCAGCAGGGACGCTATGCAA
TTTAACTAGCTGGTCCAGCAATTGGTTCGTCTCTTACACATTCAACTTCCTCTTCCAGTGGAGCTCTTCTGGTGTGTTTT
TCATATATACAATGATATCGGGTGTGGGCATCCTGTTTGTGATGAAGATGGTACCCGAGACTCGAGGTCGTTCGCTCGAA
GAAATTCAAGCTGCCATTACCCGATAA