Details for Arabidopsis Locus AT3G20395

Position : Chr3 ( 5`- 7111948 .. 7113870 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20395

Protein [Map View]
MGISKMILLKFTYVVSFWITCVIFKMSRTIKRALLGSFIFILASASVVVAAIVGAIEGHTTDIGFLQGSVLGVVAGVITA
VQLFGPVLHSDQPLSKVALLRRVVNGKAIMGLVRPFVLKAYQWQIIALDTSYMESSNLYDFNHEKKGLSKSSIQNIPMFY
NRSEHQTKSSCSICLQDWEEGEVGRKLARCGHTFHMNCIDEWLLRQETCPICRDHLSHNTTST*

DNA
ATGGGCATTTCTAAGATGATTCTTCTGAAATTCACATATGTTGTTTCTTTCTGGATTACTTGCGTGATCTTCAAAATGTC
AAGAACGATAAAACGAGCTTTGTTGGGCTCATTCATCTTCATTCTTGCTTCCGCTAGTGTTGTGGTAGCCGCCATTGTAG
GAGCCATCGAAGGTCACACCACTGACATCGGATTTCTTCAAGGTAGTGTGCTTGGAGTGGTGGCTGGAGTTATCACTGCG
GTCCAACTCTTTGGACCGGTGCTACATAGTGATCAACCTTTGTCTAAGGTGGCTTTACTCAGGAGAGTAGTGAATGGGAA
AGCCATTATGGGATTGGTTAGACCTTTTGTTCTCAAAGCATATCAATGGCAAATAATAGCATTGGATACAAGTTACATGG
AGAGTTCAAACTTATACGATTTCAATCATGAAAAAAAGGGACTATCGAAGAGCTCTATTCAGAACATCCCGATGTTCTAC
AACCGTTCAGAACATCAAACAAAATCGAGTTGCTCGATTTGCTTACAGGATTGGGAAGAAGGGGAAGTAGGAAGAAAGCT
AGCAAGATGTGGCCACACATTTCATATGAATTGCATAGATGAGTGGTTGCTTAGACAAGAAACTTGCCCCATTTGTAGAG
ACCATCTTTCACATAACACAACTTCTACATAA