Details for Arabidopsis Locus AT3G20390

Position : Chr3 ( 5`- 7109949 .. 7111824 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20390

Protein [Map View]
MTWSVFRSINTPTLDLSTALRSTRTPLVAAGVGCATFAGVSLFRMSSRSPPFASLSVSASSVKKEVVSTEKAPAALGPYS
QAIKANNLVFLSGVLGLIPETGKFVSESVEDQTEQVLKNMGEILKASGADYSSVVKTTIMLADLADFKTVNEIYAKYFPA
PSPARSTYQVAALPLNAKIEIECIATL*

DNA
ATGACTTGGTCGGTTTTCAGATCCATAAATACTCCAACACTCGACCTCTCCACCGCACTTCGCTCCACTCGTACCCCATT
GGTCGCTGCTGGTGTCGGCTGCGCAACATTCGCTGGTGTTTCTCTCTTCAGAATGTCTTCTAGATCTCCTCCTTTCGCTT
CCCTCTCTGTCTCTGCTTCTTCTGTGAAGAAGGAAGTTGTGTCTACTGAGAAAGCACCAGCTGCTTTGGGACCTTACTCT
CAGGCCATTAAAGCCAATAATCTGGTTTTTCTTTCAGGTGTTCTTGGACTTATACCTGAGACTGGAAAGTTTGTTTCGGA
GAGCGTCGAAGATCAGACTGAGCAGGTACTCAAAAACATGGGGGAGATATTGAAAGCTAGTGGTGCTGATTATTCCTCGG
TGGTGAAGACAACAATCATGTTGGCTGATTTGGCTGACTTCAAGACAGTGAACGAGATATATGCCAAATACTTCCCAGCT
CCTTCTCCAGCACGATCGACGTATCAAGTTGCAGCTTTGCCTCTAAACGCCAAGATCGAGATTGAATGTATTGCAACACT
CTAG