Details for Arabidopsis Locus AT3G20310

Position : Chr3 ( 5`- 7084806 .. 7086805 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20310

Protein [Map View]
MRKGRGSSVVGPALPVTAGGSVKEPRYRGVRKRPWGRFAAEIRDPLKKSRVWLGTFDSAVDAARAYDTAARNLRGPKAKT
NFPIDCSPSSPLQPLTYLHNQNLCSPPVIQNQIDPFMDHRLYGGGNFQEQQQQQIISRPASSSMSSTVKSCSGPRPMEAA
AASSSVAKPLHAIKRYPRTPPVAPEDCHSDCDSSSSVIDDGDDIASSSSRRKTPFQFDLNFPPLDGVDLFAGGIDDLHCT
DLRL*

DNA
ATGAGGAAAGGGAGAGGCTCTTCCGTCGTTGGACCCGCCCTTCCAGTAACCGCCGGTGGATCTGTGAAGGAGCCGAGGTA
TAGAGGCGTTAGGAAGAGACCTTGGGGTCGATTCGCAGCTGAGATCCGTGATCCATTAAAAAAATCTCGTGTCTGGCTCG
GTACTTTCGATTCCGCCGTAGATGCTGCACGCGCTTACGATACCGCCGCACGTAACCTCCGTGGTCCAAAGGCCAAGACC
AATTTCCCGATCGATTGTTCTCCTTCTTCTCCTCTCCAACCTCTCACCTACCTCCACAATCAAAACCTCTGTTCTCCTCC
GGTGATTCAGAACCAGATCGATCCGTTTATGGACCATCGGTTATACGGCGGAGGTAATTTCCAGGAGCAGCAGCAGCAGC
AGATTATTAGTCGGCCGGCGAGTAGCAGCATGAGCAGCACCGTTAAATCTTGTAGCGGACCGAGACCGATGGAAGCCGCG
GCGGCGTCTTCGTCGGTGGCGAAACCGTTACATGCGATTAAGAGATATCCGAGAACTCCACCGGTAGCTCCGGAGGATTG
TCATAGCGACTGCGATTCTTCGTCGTCTGTTATTGACGACGGAGATGATATCGCATCTTCGTCTTCCCGCCGGAAAACGC
CGTTTCAGTTTGATCTTAATTTCCCGCCGTTGGATGGCGTTGACTTATTCGCTGGCGGGATAGATGATCTCCACTGTACC
GATCTACGTCTCTGA