Details for Arabidopsis Locus AT3G20280

Position : Chr3 ( 5`- 7071193 .. 7074641 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20280

Protein [Map View]
MDIATSNAPMNLESVAMVDGNGAEPVSPPAKKPRFDEEMNRVAEIVLVLSALGRMRGGETPTALELELMFEARSKLAGMC
LEFDPKDIIRKDDVKSVIEDLGFNGKLKDQRLGFRAPTVTISEKLSLGKRKMEEAEKYPTTSTVSTGYTLSQPNGSLASP
GGLANKASVAHQWPSSEVATANTSGSHFKLDRPQMVLNGASQGTPVSSANYYAEPWSAQLPSTISFSTAPDKKVPIQSSV
RTADPSFRPFRHGTFTGTNQPMHYSQTSSFGGNHTEIAKIIHKFLQPRVKQYPLWNPPSREYMSRAMACQICEVTINEMD
TLLICDACEKAYHLKCLQGNNMKGVPKSEWHCSRCVQAFNGKPFPPTYGRATRAVATTTAKMPFRAAGVLSSSAKKIGPM
DIKANQQKPIVSTFSRLQNTGLVSGAATTSQFESASVNAKTTASAAKTTNIGSQGSKENVACGANSPAPVSLTETPNRTG
IASTISVINNGLISKPLTPVGTMSSTSPLPVVNQLPVNATSNASPSTPITASLVAQAPTVTQNGDGSSTASGTADHSILN
ADITTQVHTLTVTSSSNSQQAVSHSEVAKATEDAAPLENVSECEKPSESTSHPDSLNDKTISENVQESSKDAKVDSEACQ
NHPTASPATVVPDQDSTITAAPSVTQEDSAFNTEKTPPQPLSVSSNYDSQTEKETPNVQDSVHNVPGDSEKGKGLNGLDD
RHQEQPSEPEFYKSDSVKEENAA*

DNA
ATGGATATAGCGACCAGTAATGCTCCAATGAATCTTGAATCCGTCGCAATGGTTGATGGCAACGGAGCAGAACCGGTGTC
TCCGCCTGCGAAAAAGCCACGTTTTGACGAGGAGATGAATAGAGTGGCGGAGATTGTTCTGGTTCTATCGGCGTTAGGGA
GGATGCGTGGTGGGGAAACTCCGACGGCGTTGGAACTCGAGCTGATGTTTGAAGCTAGGTCCAAATTAGCTGGGATGTGT
CTGGAATTTGACCCTAAGGATATTATTCGTAAGGATGATGTTAAATCTGTGATTGAGGATTTGGGTTTCAATGGTAAGCT
TAAAGACCAGAGATTAGGTTTTCGAGCTCCTACGGTGACTATCTCTGAGAAGCTTTCTCTTGGTAAACGAAAGATGGAAG
AAGCAGAAAAGTATCCTACCACTTCGACAGTATCCACTGGATATACATTGTCACAGCCAAACGGTAGTCTTGCATCTCCT
GGTGGTCTTGCGAATAAAGCTTCTGTGGCTCATCAGTGGCCTAGTAGTGAAGTTGCTACTGCTAACACTAGTGGAAGCCA
TTTCAAATTGGACAGACCTCAGATGGTACTTAACGGTGCTTCTCAAGGGACTCCAGTTTCTTCCGCGAATTATTATGCTG
AACCCTGGTCTGCCCAACTTCCATCCACCATATCTTTCAGTACTGCACCAGATAAGAAGGTTCCAATTCAAAGTTCTGTC
AGGACAGCAGATCCAAGCTTTAGGCCATTCAGGCACGGTACATTCACTGGCACAAATCAGCCAATGCATTACAGTCAAAC
TTCTTCGTTCGGAGGCAACCATACTGAAATTGCTAAGATAATCCATAAATTTCTGCAACCACGGGTTAAACAATATCCTT
TGTGGAATCCACCTTCAAGAGAGTATATGAGCAGGGCAATGGCATGCCAGATATGTGAAGTTACCATCAATGAAATGGAC
ACTCTACTGATTTGTGATGCCTGTGAAAAAGCATACCACTTGAAATGTCTGCAAGGAAACAATATGAAAGGGGTTCCAAA
ATCTGAATGGCATTGCTCAAGATGTGTGCAAGCATTCAATGGGAAGCCATTTCCTCCTACATATGGGCGTGCGACTCGTG
CCGTAGCGACGACTACAGCAAAAATGCCTTTTAGGGCAGCCGGAGTTCTATCATCCTCAGCAAAGAAGATTGGACCGATG
GATATAAAGGCTAATCAACAAAAACCAATTGTATCTACGTTTTCAAGATTGCAAAATACTGGCTTGGTTTCTGGAGCAGC
AACTACATCTCAGTTTGAGTCTGCTAGTGTAAATGCAAAGACAACTGCAAGCGCAGCAAAGACTACTAACATTGGATCAC
AGGGCTCTAAGGAAAATGTTGCCTGTGGTGCTAATTCTCCAGCACCGGTATCGCTTACCGAGACTCCAAATCGTACAGGA
ATCGCAAGTACAATTTCTGTGATAAACAATGGCCTCATTTCAAAACCTTTAACACCAGTTGGTACTATGAGCAGCACTTC
TCCATTGCCTGTTGTTAACCAACTTCCCGTGAATGCAACCTCAAACGCAAGTCCGAGTACACCAATAACTGCTAGCCTTG
TAGCACAAGCCCCGACAGTTACCCAAAATGGAGATGGCAGCTCAACGGCCTCTGGGACTGCTGACCATTCTATATTGAAT
GCTGACATTACCACTCAAGTTCATACATTGACTGTTACTTCCAGTAGTAATTCTCAACAGGCAGTGTCACATTCTGAGGT
TGCAAAAGCAACTGAAGATGCAGCTCCTTTGGAAAATGTTTCCGAGTGTGAGAAACCATCAGAATCTACATCTCACCCAG
ACTCTCTGAATGATAAAACAATATCAGAGAACGTTCAAGAATCAAGTAAGGATGCTAAAGTTGATTCTGAAGCTTGCCAG
AACCACCCAACAGCATCCCCAGCCACTGTTGTACCAGATCAAGACTCGACGATCACTGCTGCACCATCCGTGACACAAGA
GGATTCAGCTTTCAATACAGAGAAAACACCACCTCAGCCACTTTCGGTGTCATCTAACTATGATTCACAAACCGAGAAGG
AAACACCAAATGTCCAAGATTCTGTACATAATGTTCCGGGAGATTCAGAGAAGGGTAAAGGGTTAAATGGTTTAGATGAT
AGACATCAGGAACAGCCTTCTGAGCCGGAGTTCTATAAGTCAGATTCGGTAAAGGAAGAAAATGCTGCCTAA