Details for Arabidopsis Locus AT3G20270

Position : Chr3 ( 5`- 7067057 .. 7070946 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20270

Protein [Map View]
MNRSKEENVAPTMKDDSPFGKLTEDLLIEIFIRIPITNWEQVSCVRKQWANLFRGECLWLAALNRAYPLASKTKSWIGPI
RQGLSKRRYVALYISRNILGVDDTDIDEMLGHIYVFLNDQLQLSTMPASGILHGTLIDQLIVCGQSKEEAGELATKIWLA
LLDNLEDTKHTFTVLKSIAQEYDGFLPYPYSRPIKVQWKVFEKLFVDFRDLLDHSEYCDLIGIAKNKFQTIPYFSYPSTL
FFFLEMALMKVMTILVLFVSVSSTLAQSNNGGHISIIVSETGLEFAKDYLIKKVITTTLPLQLPDIENKVKIPLIGKVRM
GLSNIQIDAVHVQSSKMETRKDGIILSVLGATANLSMDWSYTYRASFFEISDHGDASVEVKGMNVRITATLVNDNGSLKI
ASRENDCTVKNIDIHINGGASWLYQGVVDAFQKMIISTVEKTVSTKIVEKMKKLDSFLQSLPKQRKIDDSAAVNLTFTGN
PVLGNSSVEVDINGLFMPKGDDIKVAGSRSSSFFGGVNKRMVTISVEEGVFNSATLVYFNAKVMHLVMEETKNGSILSTS
DWKLILPELYKHYPDNKMVLNMSVTSPPAVKITENGIDATIQLDIAFDVQDSGENLSVARLSTILSVACSTEIVKNNLIG
SLRLNDFNATMKWSKIGEFQTNYVQAATSRILEALFLPYVNTRLKRGFPLPIPGDFTIKNIKIVYVNSGILVCTDIGTST
NQ*

DNA
ATGAACCGAAGTAAAGAAGAGAACGTTGCTCCGACAATGAAAGATGATAGTCCATTTGGAAAGCTTACAGAGGATCTCTT
GATAGAGATATTTATCAGAATTCCAATAACAAATTGGGAACAAGTATCGTGTGTTAGAAAGCAGTGGGCTAATTTATTCC
GCGGAGAATGCTTATGGCTGGCTGCTCTTAATCGGGCGTATCCACTTGCTAGCAAAACTAAGAGCTGGATTGGACCAATT
CGTCAAGGATTAAGCAAACGGAGATATGTGGCTTTATACATCAGCAGAAACATATTAGGTGTGGATGATACAGACATAGA
TGAGATGCTTGGACATATTTACGTGTTCTTGAATGATCAGCTTCAACTTTCCACTATGCCTGCTTCAGGCATTTTGCATG
GAACCCTTATCGACCAATTGATTGTTTGTGGCCAATCGAAAGAAGAAGCTGGTGAGCTTGCAACAAAGATTTGGCTGGCT
CTTCTTGACAATTTAGAGGACACAAAACATACATTTACCGTGCTGAAATCAATCGCACAAGAATATGATGGCTTTCTTCC
ATATCCATATTCAAGACCAATCAAAGTGCAGTGGAAGGTGTTCGAGAAACTGTTTGTAGATTTCCGTGACTTGCTTGATC
ATTCAGAGTACTGCGACTTAATAGGAATTGCCAAAAATAAGTTTCAAACCATACCTTATTTCAGTTATCCATCCACTTTA
TTCTTCTTCTTGGAAATGGCTCTCATGAAAGTAATGACGATTCTGGTTCTCTTCGTCTCGGTGTCATCGACCTTGGCGCA
ATCCAACAATGGCGGTCACATTTCGATAATCGTCTCGGAAACAGGTCTTGAATTTGCTAAAGATTACCTCATCAAGAAAG
TGATCACTACGACGCTTCCACTTCAGCTACCAGACATTGAGAATAAGGTTAAGATCCCTCTAATCGGGAAAGTTCGAATG
GGTCTATCGAATATTCAGATTGATGCAGTTCATGTCCAGTCTTCGAAGATGGAGACTCGAAAAGATGGAATCATTTTGAG
TGTTTTAGGTGCTACAGCAAATTTGAGTATGGACTGGTCTTATACTTACAGAGCTTCCTTCTTTGAGATTTCTGATCATG
GAGATGCTTCTGTTGAGGTTAAAGGAATGAATGTGAGAATCACTGCCACTTTGGTTAATGATAATGGAAGTCTAAAGATT
GCCTCACGGGAAAATGATTGTACAGTAAAGAACATTGATATTCATATCAATGGTGGTGCTTCTTGGCTATATCAAGGGGT
GGTTGATGCATTTCAAAAAATGATTATATCTACTGTTGAAAAAACTGTCTCTACTAAAATTGTAGAAAAAATGAAGAAGC
TTGATTCTTTCTTGCAATCACTTCCAAAACAGAGAAAGATTGATGACTCTGCTGCAGTGAATCTCACTTTTACAGGCAAC
CCTGTCTTAGGGAATTCGTCGGTTGAAGTTGACATCAATGGTTTATTCATGCCAAAGGGTGATGATATTAAAGTTGCAGG
GTCTCGTTCTTCTTCCTTCTTTGGTGGGGTTAATAAGAGAATGGTGACAATTTCAGTAGAAGAAGGAGTTTTCAACTCTG
CAACACTTGTCTACTTCAACGCTAAGGTGATGCATTTAGTTATGGAGGAAACAAAGAACGGGTCCATTCTAAGCACATCT
GACTGGAAACTCATCCTTCCAGAGCTGTACAAACATTATCCAGATAATAAAATGGTGCTTAACATGTCAGTAACATCTCC
TCCTGCTGTTAAAATCACAGAGAATGGAATTGATGCGACGATTCAGCTAGATATAGCGTTCGATGTTCAAGACTCTGGAG
AAAATCTATCTGTAGCACGCCTATCAACAATTCTGAGTGTTGCGTGTTCTACAGAAATCGTAAAGAATAATCTAATCGGT
AGCCTCAGATTAAATGATTTCAATGCAACAATGAAGTGGAGTAAAATTGGAGAGTTTCAAACAAACTATGTTCAGGCTGC
TACGTCTAGGATTCTTGAAGCCTTGTTTTTGCCGTACGTAAACACACGTCTCAAGAGAGGATTCCCTTTGCCGATTCCCG
GCGATTTCACGATCAAAAACATAAAGATTGTTTATGTTAATAGTGGCATTTTGGTATGTACCGATATCGGCACTAGCACA
AACCAGTAA