Details for Arabidopsis Locus AT3G20260

Position : Chr3 ( 5`- 7064054 .. 7066503 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20260

Protein [Map View]
MDFLKVRKFRKSRKPNLEKEKEDKILAQQEQARSENTEAGVIDSGKGDEIEDDDDDFITNEVKRRLKELRRNSFMVLIPE
EEEEEEEESYLDEDDDDGEDKCSSEWRDVVAEGLQWWGGFDAVYEKYCERMLFFDRLSSQQLKETGIGIAPSPSTPSPRS
ASKKLSSPFRCLSLKKFDVPEEDIEHLQPTEVDDPYQDLETAYVAQLCLTWEALHCQYTQLSHLISCQPETPTCYNHTAQ
LFQQFLVLLQRYIENEPFEQGSRSELYARARNAMPKLLQAPKIQGSDKKEMEKDTGFMVLADDLIKVIESSILTFNVFLK
MDKKKPNGGIHLFGNHNNNHVNSTTPLLLVQSSIDKKRVKAKELSKKTKGLRKKSWPQTWEGVQLLFAAIDIKLATRVLR
MSKISKEQLLWCEEKMKKLNFSAGKLQRHPSPILFPC*

DNA
ATGGATTTCTTGAAAGTTAGAAAATTTCGAAAGTCTCGGAAGCCAAACCTTGAAAAGGAGAAAGAAGACAAGATATTGGC
TCAGCAAGAACAGGCAAGGAGTGAGAACACTGAAGCTGGTGTGATAGATTCGGGGAAAGGAGATGAGATCGAAGATGACG
ATGATGATTTCATTACCAATGAGGTTAAGAGAAGGCTCAAGGAGTTGAGGAGAAACAGTTTCATGGTGTTGATACCTGAG
GAAGAAGAAGAAGAAGAAGAGGAATCGTATCTAGATGAAGATGATGATGACGGAGAAGACAAGTGTTCAAGTGAGTGGAG
AGATGTGGTTGCTGAAGGACTTCAATGGTGGGGAGGTTTTGATGCTGTCTATGAAAAGTATTGCGAGCGTATGCTCTTCT
TTGATCGTTTAAGCTCTCAGCAGCTCAAGGAAACTGGCATTGGAATTGCTCCAAGTCCTTCAACTCCATCGCCAAGATCT
GCATCTAAGAAGCTGTCATCGCCTTTCCGATGTCTTTCTCTCAAAAAGTTTGATGTTCCGGAGGAAGATATCGAGCATTT
GCAGCCGACAGAAGTTGACGACCCTTATCAAGATCTAGAGACGGCCTATGTTGCTCAACTCTGCCTCACTTGGGAGGCAC
TTCACTGTCAATACACGCAGCTGAGCCACTTAATCTCATGCCAACCCGAAACCCCGACTTGCTACAACCATACTGCCCAA
CTGTTTCAGCAATTCCTAGTCTTGTTGCAGAGGTATATAGAGAATGAACCGTTTGAGCAAGGCTCAAGATCGGAACTTTA
TGCTCGTGCTAGAAATGCAATGCCTAAGCTACTTCAAGCTCCTAAGATTCAAGGGTCAGATAAAAAGGAGATGGAGAAAG
ATACAGGCTTCATGGTCCTCGCTGATGATCTCATCAAAGTCATAGAGAGCTCGATCCTTACTTTCAACGTCTTCTTGAAA
ATGGATAAGAAGAAACCAAATGGGGGTATTCACTTGTTTGGGAACCACAACAACAACCATGTGAATTCTACAACTCCTTT
ACTACTGGTTCAGTCATCCATTGATAAGAAAAGGGTGAAAGCAAAGGAGCTTTCAAAGAAGACAAAAGGGCTGAGAAAGA
AATCATGGCCTCAAACATGGGAAGGTGTTCAACTCTTGTTTGCAGCCATTGACATCAAACTCGCAACACGGGTTTTGAGG
ATGTCGAAAATCAGTAAAGAGCAACTTCTATGGTGTGAAGAAAAGATGAAAAAGCTCAACTTTTCAGCTGGGAAGCTTCA
AAGACACCCATCTCCAATTCTTTTCCCTTGTTGA