Details for Arabidopsis Locus AT3G20240

Position : Chr3 ( 5`- 7057011 .. 7058891 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20240

Protein [Map View]
MAMVVPKEGLVVMDKESVSSASSDSHLRLQPHFPDFTIPVKDFFKSREAREFLSGALAGAMTKAVLAPLETIRTRMIVGV
GSRSIPGSFLEVVQKQGWQGLWAGNEINMIRIIPTQAIELGTFEWVKRAMTSAQVKLKKIEDAKIEIGDFSFSPSISWIS
PVAVAGASAGIASTLVCHPLEVLKDRLTVSPEIYPSLSLAIPRIFRADGIRGFYAGLGPTLVGMLPYSTCYYFMYDKMKT
SYCKSKNKKALSRPEMLVLGALAGLTASTISFPLEVARKRLMVGALKGECPPNMAAAIAEVVKKEGVMGLYRGWGASCLK
VMPSSGITWVFYEAWKDILLAANTKPLI*

DNA
ATGGCAATGGTTGTTCCAAAAGAAGGGCTTGTGGTTATGGACAAGGAATCTGTTTCTTCAGCTTCATCGGATTCTCATCT
TCGTCTCCAACCTCACTTTCCTGACTTCACTATTCCTGTTAAAGATTTCTTCAAGTCTAGGGAAGCCCGTGAGTTTCTTA
GTGGGGCTTTAGCTGGAGCTATGACCAAAGCTGTTCTTGCTCCACTTGAGACTATAAGGACAAGAATGATTGTTGGTGTT
GGATCGAGAAGCATTCCAGGTAGTTTTCTGGAAGTTGTACAGAAGCAAGGGTGGCAAGGTCTTTGGGCTGGCAATGAAAT
CAATATGATTCGAATCATTCCAACGCAAGCAATTGAGTTAGGGACATTCGAGTGGGTAAAACGTGCAATGACATCAGCTC
AAGTGAAGTTGAAGAAGATTGAGGACGCCAAGATTGAAATCGGTGATTTTAGTTTCAGTCCGTCCATATCGTGGATCTCT
CCTGTTGCTGTGGCTGGTGCATCTGCTGGTATTGCCAGTACACTTGTTTGCCATCCTCTCGAAGTCCTCAAGGATAGATT
GACTGTGAGCCCTGAGATTTATCCAAGCTTAAGCCTTGCAATTCCAAGAATTTTTAGAGCCGATGGAATCCGTGGATTTT
ACGCTGGCTTAGGACCAACATTGGTCGGGATGCTTCCTTACAGCACATGTTATTACTTCATGTATGACAAAATGAAGACC
TCATACTGCAAATCCAAGAACAAAAAGGCTTTAAGCCGTCCAGAGATGCTTGTTCTTGGAGCTTTAGCTGGTCTAACGGC
GAGCACCATAAGCTTCCCCTTGGAAGTAGCGCGGAAGCGGTTGATGGTTGGAGCTCTGAAGGGAGAATGCCCACCAAACA
TGGCTGCAGCAATAGCAGAAGTAGTGAAGAAAGAAGGAGTGATGGGACTCTACAGAGGATGGGGAGCAAGTTGTTTGAAA
GTCATGCCATCTTCAGGCATTACTTGGGTCTTCTATGAAGCCTGGAAAGATATTTTGCTTGCCGCCAACACCAAACCACT
CATATAA