Details for Arabidopsis Locus AT3G20230

Position : Chr3 ( 5`- 7055353 .. 7056758 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20230

Protein [Map View]
MSCLISSTCSLVPFDSNLTRSNRFTKLGSAVSWQSSFPKLSIEIGSVISSPIVKKDSFVQAAWTRRSRGEAAKRPNRKSW
KQRTDMYMRPFLLNVFFSRKFIHAKVMHRPTSKVISVATTNARDIRTNIPSLVDNEACRLIGKLIAERSMEADVYAVSYE
PRKGERIEGKLGIVIDTIKEHGIIFVP*

DNA
ATGTCTTGCTTGATTTCATCAACTTGCTCACTCGTCCCCTTCGACTCGAATCTGACTCGTTCGAATCGTTTCACCAAACT
GGGTTCTGCAGTTTCATGGCAATCTTCCTTTCCTAAACTCTCCATCGAAATCGGCTCTGTTATCTCATCCCCCATTGTCA
AGAAGGATTCTTTTGTGCAAGCTGCGTGGACTCGAAGATCACGAGGTGAAGCAGCGAAAAGACCCAACAGGAAGTCATGG
AAACAGAGAACGGACATGTACATGAGGCCTTTCCTTCTGAATGTGTTCTTCTCCAGGAAATTCATACACGCTAAAGTGAT
GCATAGGCCAACAAGCAAAGTCATTTCAGTTGCCACCACAAATGCTAGAGATATAAGGACTAATATACCGTCTCTTGTTG
ATAACGAAGCGTGTAGACTCATCGGTAAGCTCATAGCTGAGCGTTCAATGGAAGCAGACGTCTATGCTGTCTCTTATGAG
CCAAGAAAGGGAGAAAGAATTGAAGGGAAGCTAGGGATTGTAATCGATACTATTAAGGAACATGGCATTATTTTTGTTCC
TTGA