Details for Arabidopsis Locus AT3G20220

Position : Chr3 ( 5`- 7054828 .. 7055456 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20220

Protein [Map View]
MISLSFIVRLANQENRRNRRYETNIKDRLVSGELSDGSRPARDQNGVPRGHLAVYVGREERQRFVIPTKYLQYPEFRSLM
DEVADEFGYDHEGGIHIPCEESVFEEILIRYMSCDKKK*

DNA
ATGATTTCGCTAAGTTTCATCGTGCGTCTAGCAAACCAGGAGAACAGACGAAACAGAAGGTACGAAACTAACATTAAGGA
TCGTCTTGTCTCGGGGGAGTTATCGGACGGTAGCAGACCAGCCAGAGATCAAAACGGTGTCCCGAGAGGACATCTTGCGG
TCTATGTGGGGCGCGAAGAGAGGCAAAGGTTTGTGATACCGACCAAGTATCTTCAATATCCTGAATTTAGGAGTTTGATG
GATGAAGTAGCGGACGAGTTTGGGTACGATCATGAAGGAGGGATTCATATTCCTTGTGAAGAAAGTGTTTTTGAAGAGAT
TTTGATTAGATACATGTCTTGTGACAAGAAGAAATAA