Details for Arabidopsis Locus AT3G20210

Position : Chr3 ( 5`- 7052382 .. 7055452 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20210

Protein [Map View]
MSSPLGHFQILVFLHALLIFSAESRKTQLLNDNDVESSDKSAKGTRWAVLVAGSNEYYNYRHQADICHAYQILRKGGLKD
ENIIVFMYDDIAFSSENPRPGVIINKPDGEDVYKGVPKDYTKEAVNVQNFYNVLLGNESGVTGGNGKVVKSGPNDNIFIY
YADHGAPGLIAMPTGDEVMAKDFNEVLEKMHKRKKYNKMVIYVEACESGSMFEGILKKNLNIYAVTAANSKESSWGVYCP
ESYPPPPSEIGTCLGDTFSISWLEDSDLHDMSKETLEQQYHVVKRRVGSDVPETSHVCRFGTEKMLKDYLSSYIGRNPEN
DNFTFTESFSSPISNSGLVNPRDIPLLYLQRKIQKAPMGSLESKEAQKKLLDEKNHRKQIDQSITDILRLSVKQTNVLNL
LTSTRTTGQPLVDDWDCFKTLVNSFKNHCGATVHYGLKYTGALANICNMGVDVKQTVSAIEQASNQENRRNRRYETNIKD
RLVSGELSDGSRPARDQNGVPRGHLAVYVGREERQRFVIPTKYLQYPEFRSLMDEVADEFGYDHEGGIHIPCEESVFEEI
LIRYMSCDKKK*

DNA
ATGTCTAGTCCTCTTGGTCACTTTCAGATTCTTGTTTTTCTTCATGCTTTGCTTATCTTCTCAGCTGAGTCCCGCAAAAC
CCAATTGCTGAACGATAATGATGTTGAATCTAGCGACAAGAGTGCAAAAGGCACACGATGGGCTGTTTTAGTTGCTGGAT
CAAATGAATATTATAACTACAGGCATCAGGCTGACATATGCCACGCGTATCAGATACTCCGAAAAGGCGGTTTAAAAGAT
GAAAACATCATTGTGTTTATGTATGATGATATCGCGTTTTCCTCGGAGAATCCTAGGCCTGGAGTTATCATTAATAAACC
AGATGGAGAAGATGTTTATAAAGGAGTTCCTAAGGACTACACTAAAGAAGCTGTTAATGTTCAAAACTTCTACAATGTGT
TACTTGGAAATGAAAGTGGCGTCACAGGAGGAAATGGCAAAGTTGTGAAAAGTGGTCCTAATGATAATATCTTCATCTAT
TATGCTGACCATGGAGCTCCTGGCTTAATAGCGATGCCCACTGGTGATGAAGTTATGGCAAAAGATTTCAATGAAGTCTT
GGAGAAGATGCATAAGAGAAAAAAATACAACAAGATGGTGATCTATGTTGAAGCATGTGAATCAGGAAGTATGTTTGAAG
GGATTTTAAAGAAAAATCTCAACATATACGCAGTGACTGCTGCTAATTCTAAAGAGAGCAGCTGGGGAGTTTACTGTCCT
GAGTCATATCCTCCTCCTCCTTCTGAGATTGGAACTTGTCTCGGCGATACATTTAGCATCTCTTGGCTTGAGGACAGTGA
CCTTCATGACATGAGCAAAGAGACTTTGGAGCAACAATACCACGTTGTAAAGAGAAGAGTAGGATCTGATGTACCAGAGA
CTTCTCATGTATGCCGTTTCGGAACAGAGAAGATGCTTAAAGATTATCTTTCCTCTTACATTGGAAGAAATCCTGAAAAC
GATAACTTCACTTTCACGGAATCCTTTTCCTCACCAATCTCTAATTCTGGCTTGGTCAATCCGCGCGATATTCCTCTGCT
ATACCTCCAGAGAAAGATTCAAAAAGCTCCAATGGGATCACTTGAAAGCAAAGAAGCTCAGAAGAAATTGCTTGACGAAA
AGAATCATAGGAAACAAATCGATCAGAGCATTACAGACATTCTGCGGCTTTCAGTTAAACAAACCAATGTCTTAAATCTC
TTAACTTCCACAAGAACAACAGGACAGCCTCTTGTAGACGATTGGGATTGCTTCAAGACTCTAGTTAATAGCTTCAAGAA
TCACTGCGGTGCAACGGTGCATTACGGATTGAAGTATACAGGAGCGCTTGCCAATATCTGCAATATGGGAGTGGATGTGA
AGCAAACTGTTTCAGCCATTGAACAAGCTTCAAACCAGGAGAACAGACGAAACAGAAGGTACGAAACTAACATTAAGGAT
CGTCTTGTCTCGGGGGAGTTATCGGACGGTAGCAGACCAGCCAGAGATCAAAACGGTGTCCCGAGAGGACATCTTGCGGT
CTATGTGGGGCGCGAAGAGAGGCAAAGGTTTGTGATACCGACCAAGTATCTTCAATATCCTGAATTTAGGAGTTTGATGG
ATGAAGTAGCGGACGAGTTTGGGTACGATCATGAAGGAGGGATTCATATTCCTTGTGAAGAAAGTGTTTTTGAAGAGATT
TTGATTAGATACATGTCTTGTGACAAGAAGAAATAA