Details for Arabidopsis Locus AT3G20190

Position : Chr3 ( 5`- 7044943 .. 7047390 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20190

Protein [Map View]
MLTWETPVMLASNTASTKKLAFITTFLIIVLCPVTMVMSQPQADVLPLPASDADCLLRFKDTLVNASFISSWDPSISPCK
RNSENWFGVLCVTGNVWGLQLEGMGLTGKLDLEPLAAIKNLRTLSFMNNKFNGSMPSVKNFGALKSLYLSNNRFTGEIPA
DAFDGMHHLKKLLLANNAFRGSIPSSLAYLPMLLELRLNGNQFHGEIPYFKQKDLKLASFENNDLEGPIPESLSNMDPVS
FSGNKNLCGPPLSPCSSDSGSSPDLPSSPTEKNKNQSFFIIAIVLIVIGIILMIISLVVCILHTRRRKSLSAYPSAGQDR
TEKYNYDQSTDKDKAADSVTSYTSRRGAVPDQNKLLFLQDDIQRFDLQDLLRASAEVLGSGSFGSSYKTGINSGQMLVVK
RYKHMNNVGRDEFHEHMRRLGRLKHPNLLPIVAYYYRREEKLLIAEFMPNRSLASHLHANHSVDQPGLDWPTRLKIIQGV
AKGLGYLFNELTTLTIPHGHLKSSNVVLDESFEPLLTDYALRPVMNSEQSHNLMISYKSPEYSLKGHLTKKTDVWCLGVL
ILELLTGRFPENYLSQGYDANMSLVTWVSNMVKEKKTGDVFDKEMTGKKNCKAEMLNLLKIGLSCCEEDEERRMEMRDAV
EKIERLKEGEFDNDFASTTHNVFASRLIDDDDFGFAMNR*

DNA
ATGCTAACTTGGGAGACCCCAGTTATGCTTGCAAGCAACACCGCCTCAACCAAAAAGCTAGCCTTCATTACCACCTTTCT
CATCATTGTGTTATGTCCGGTCACAATGGTCATGTCTCAGCCGCAGGCGGATGTTTTGCCACTGCCAGCCTCAGACGCAG
ATTGCCTCTTGAGATTTAAAGATACTTTGGTTAATGCATCGTTCATTAGCAGTTGGGATCCTTCCATCTCCCCGTGTAAG
CGAAACTCAGAGAATTGGTTCGGTGTTCTCTGTGTTACCGGTAATGTTTGGGGCCTACAACTCGAAGGAATGGGCTTAAC
CGGGAAGCTTGACCTTGAACCATTAGCTGCAATCAAGAATCTACGAACCTTGAGCTTCATGAACAACAAATTTAACGGTT
CAATGCCATCTGTCAAGAATTTTGGTGCGTTGAAATCATTGTACTTGTCTAACAACCGGTTTACAGGGGAGATACCCGCG
GATGCGTTTGATGGTATGCATCATTTGAAGAAGCTTCTGTTGGCTAACAACGCGTTTCGAGGGAGTATCCCTTCTTCTTT
AGCTTATTTGCCAATGCTTTTAGAGTTGAGGCTAAATGGGAATCAGTTTCATGGGGAAATACCTTATTTTAAACAAAAGG
ACCTTAAGTTGGCTAGCTTCGAAAACAATGACCTCGAGGGACCTATACCGGAAAGCCTTAGCAACATGGATCCTGTCTCC
TTTTCAGGGAACAAGAACTTGTGTGGTCCTCCACTAAGCCCATGTTCGAGTGATTCAGGATCTTCTCCGGATCTCCCTTC
TAGTCCCACGGAAAAGAACAAGAACCAATCTTTCTTCATCATTGCAATTGTTCTGATTGTCATTGGGATAATACTGATGA
TCATTTCGCTTGTGGTCTGTATCCTTCATACCAGAAGACGCAAGAGTTTGTCGGCTTATCCATCCGCGGGTCAGGACAGG
ACAGAGAAATACAACTACGATCAATCTACGGACAAGGATAAAGCTGCAGATTCTGTAACGAGTTACACTAGTAGAAGAGG
AGCAGTACCGGATCAGAATAAACTCTTGTTTTTGCAAGATGACATTCAAAGATTTGACCTTCAAGATCTTCTTAGAGCCT
CTGCTGAAGTTCTTGGGAGCGGAAGCTTTGGCTCTTCTTATAAAACTGGGATAAATAGCGGACAGATGCTGGTCGTGAAG
AGGTATAAACATATGAACAATGTTGGAAGAGATGAGTTTCATGAGCATATGAGACGGTTAGGGAGATTGAAACATCCGAA
TCTGTTGCCTATTGTGGCTTACTATTACCGCAGAGAAGAGAAGCTCTTGATCGCTGAGTTCATGCCAAATCGTAGCTTGG
CAAGCCATCTTCACGCGAATCATTCTGTGGATCAACCGGGATTGGATTGGCCAACAAGGCTAAAGATTATACAAGGAGTG
GCTAAGGGTTTAGGTTACTTGTTCAACGAGCTAACAACCCTAACAATCCCTCACGGTCATCTCAAGTCATCGAACGTTGT
ATTGGACGAATCATTTGAGCCACTCCTAACCGATTATGCACTAAGACCAGTGATGAACTCAGAGCAGTCTCACAATCTAA
TGATCTCTTATAAATCACCAGAGTATAGCTTAAAGGGACATCTAACTAAAAAGACAGATGTTTGGTGCCTGGGGGTATTG
ATCTTGGAGCTTTTAACAGGTAGGTTTCCGGAGAATTATCTAAGCCAAGGGTACGATGCTAACATGAGCCTCGTAACTTG
GGTGAGCAACATGGTTAAGGAGAAGAAAACAGGTGACGTGTTTGACAAGGAAATGACTGGGAAGAAAAACTGCAAAGCAG
AGATGCTAAACCTTTTGAAAATCGGGTTGAGTTGTTGCGAAGAAGATGAAGAAAGGAGGATGGAGATGAGAGATGCTGTG
GAGAAGATAGAGAGGTTAAAAGAAGGAGAGTTTGACAATGATTTCGCATCGACGACACATAATGTCTTTGCTTCTCGGTT
GATAGACGACGATGACTTTGGTTTCGCCATGAATCGATGA