Details for Arabidopsis Locus AT3G20180

Position : Chr3 ( 5`- 7043385 .. 7043841 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20180

Protein [Map View]
MRIKLSVNSEKCRKKAMQVAVAADGVTSVAMEGEFQDELVVVGDGVDSASLIMALRKKACHVTLETLEEVKKPQVEEKSI
TPHCCIAQCPVVSNEQPRPEVYRIVHDSYGPTTGCLVM*

DNA
ATGCGTATCAAACTGTCAGTGAATAGTGAAAAATGCAGGAAGAAGGCAATGCAAGTAGCAGTTGCTGCAGATGGTGTAAC
TTCAGTGGCCATGGAAGGAGAATTTCAGGATGAGCTTGTGGTTGTTGGAGATGGAGTGGATTCAGCTTCTTTGATTATGG
CCTTAAGGAAGAAAGCATGTCATGTCACTCTTGAGACTCTTGAAGAAGTGAAGAAGCCACAGGTCGAAGAGAAGTCTATT
ACACCGCATTGCTGCATAGCTCAATGTCCTGTGGTTAGCAATGAGCAGCCAAGGCCTGAGGTTTATAGAATAGTGCATGA
TTCTTATGGTCCAACCACTGGGTGCTTAGTTATGTAA