Details for Arabidopsis Locus AT3G20060

Position : Chr3 ( 5`- 7002817 .. 7004450 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20060

Protein [Map View]
MATVNGYTGNTPAATTPAATGSKQSAPPTKTVDSHSVLKRLQSELMGLMMGADPGISAFPEEDNIFCWKGTITGSKDTVF
EGTEYRLSLTFSNDYPFKSPKVKFETCCFHPNVDLYGNICLDILQDKWSSAYDVRTILLSIQSLLGEPNISSPLNNQAAQ
LWSNQEEYRKMVEKLYKPLNA*

DNA
ATGGCGACGGTTAATGGGTACACAGGGAATACTCCGGCGGCGACTACACCGGCAGCCACCGGATCAAAGCAATCTGCTCC
TCCGACTAAGACCGTCGATAGCCACTCCGTTCTAAAAAGGCTGCAATCTGAACTAATGGGATTGATGATGGGAGCTGATC
CGGGGATATCTGCGTTTCCAGAGGAAGACAACATATTTTGCTGGAAAGGAACAATTACAGGAAGCAAAGATACTGTGTTC
GAAGGAACTGAGTACAGACTCTCACTCACTTTCTCTAACGATTATCCTTTTAAGTCTCCCAAAGTTAAGTTTGAGACATG
CTGCTTCCACCCCAATGTGGATCTCTATGGCAATATTTGCTTGGACATTCTTCAGGATAAATGGTCATCTGCTTATGATG
TGAGGACGATATTACTCTCAATTCAAAGCCTTCTCGGAGAACCGAACATCAGCTCACCATTGAACAATCAAGCGGCTCAG
CTTTGGAGCAATCAAGAAGAGTACAGGAAGATGGTTGAGAAGCTCTACAAGCCTTTAAACGCATGA