Details for Arabidopsis Locus AT3G20040

Position : Chr3 ( 5`- 6994894 .. 6998171 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20040

Protein [Map View]
MGKVLVMLTAAAAVVACSVATVMVRRRMKGRRKWRRVVGLLKDLEEACETPLGRLRQMVDAIAVEMQAGLVSEGGSKLKM
LLTFVDDLPNGSETGTYYALHLGGSYFRIIKVHLGGQRSSLEVQDVERHSIPTSLMNSTSEVLFDFLASSLQRFIEKEGN
DFSLSQPLKRELAFTFSFPVKQTSISSGVLIKWTKGFAISEMAGEDIAECLQGALNKRGLDIRVAALVNDTVGALSFGHF
HDPDTIAAVVFGTGSNACYLERTDAIIKCQNPRTTSGSMVVNMEWGNFWSSRLPRTSYDLELDAESMNSNDMGFEKMIGG
MYLGDIVRRVILRMSQESDIFGPISSILSTPFVLRTNSVSAMHEDDTSELQEVARILKDLGVSEVPMKVRKLVVKICDVV
TRRAARLAAAGIAGILKKVGRDGSGGGRRSDKQIMRRTVVAVEGGLYLNYRMFREYMDEALRDILGEDVAQHVVVKAMED
GSSIGSALLLASSQSVQTIPSV*

DNA
ATGGGGAAGGTTTTGGTGATGTTGACGGCAGCTGCGGCTGTGGTGGCTTGTTCAGTGGCGACTGTGATGGTGAGAAGGAG
GATGAAAGGGAGGAGGAAATGGAGGAGGGTGGTGGGTTTACTTAAGGATTTGGAGGAAGCTTGTGAGACGCCTTTAGGAA
GGTTGAGGCAGATGGTTGATGCCATAGCTGTGGAGATGCAAGCTGGTTTGGTTTCTGAAGGAGGGTCAAAGCTTAAAATG
TTGCTCACTTTTGTTGATGATCTTCCCAATGGGAGCGAGACAGGAACCTATTATGCACTTCATCTTGGAGGCTCCTACTT
TAGGATAATAAAGGTTCATCTAGGTGGTCAAAGATCATCTCTTGAAGTTCAAGATGTTGAACGACATTCCATACCAACAT
CTTTGATGAATAGCACTAGCGAGGTTCTCTTCGACTTTCTCGCATCATCCTTGCAGAGGTTTATTGAAAAAGAAGGGAAC
GATTTCAGTTTGTCACAACCTTTAAAAAGGGAACTTGCGTTTACTTTTTCTTTCCCAGTCAAGCAGACATCCATCTCATC
AGGAGTTCTAATTAAATGGACCAAAGGTTTTGCAATTAGTGAAATGGCTGGGGAAGACATTGCTGAATGTCTACAAGGAG
CGTTGAACAAGAGAGGGCTAGATATTCGCGTTGCAGCTCTTGTGAATGATACTGTTGGGGCTTTATCCTTTGGACATTTT
CATGACCCAGACACAATTGCTGCTGTTGTCTTTGGAACAGGTAGTAATGCATGTTACCTTGAACGAACTGATGCCATAAT
CAAGTGTCAAAATCCACGCACGACTTCTGGAAGCATGGTGGTCAATATGGAGTGGGGAAACTTTTGGTCATCTCGTCTGC
CAAGAACTTCATATGACCTTGAGTTGGATGCAGAGAGTATGAATTCAAATGACATGGGCTTTGAGAAGATGATAGGAGGG
ATGTATCTGGGCGACATTGTCCGCAGAGTAATTCTTCGAATGTCACAAGAGTCCGACATCTTTGGACCTATCTCATCCAT
TTTATCCACGCCTTTCGTTCTGAGAACAAATTCTGTCTCAGCAATGCATGAAGATGACACATCCGAGTTACAAGAAGTAG
CACGAATCTTGAAAGATTTAGGGGTGTCAGAGGTACCAATGAAGGTGAGGAAACTTGTAGTGAAGATCTGCGATGTAGTG
ACACGCAGAGCAGCTAGGCTAGCAGCAGCAGGAATTGCAGGAATCTTGAAGAAGGTAGGGAGAGATGGGAGCGGAGGAGG
AAGGAGAAGCGATAAGCAGATAATGAGAAGAACAGTGGTGGCAGTTGAAGGAGGTCTGTATTTGAACTACAGGATGTTCA
GAGAATATATGGACGAAGCTCTGAGAGATATACTGGGAGAAGATGTGGCTCAACACGTAGTGGTGAAGGCCATGGAAGAT
GGTTCCAGCATTGGCTCTGCATTGTTGCTGGCTTCGTCACAAAGTGTTCAAACAATACCATCCGTATGA