Details for Arabidopsis Locus AT3G19960

Position : Chr3 ( 5`- 6948774 .. 6956966 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19960

Protein [Map View]
MSQKVTPFMQSLKSLPADYRFDGSPVSDRLENSSGASVRLTNSNVPRKGGLRNGVSRTDTAAGDSEDSPYSGHGVFVEEQ
SLTDDVDSGAATMPLPQSDERRWSDTSAYARKKILQSWIQLPNGNWELGKILSTSGEESVISLPEGKVIKVISETLVPAN
PDILDGVDDLMQLSYLNEPSVLYNLNYRYNQDMIYTKAGPVLVAVNPFKEVPLYGNRYIEAYRKKSNESPHVYAIADTAI
REMIRDEVNQSIIIRCICIHESMTYSISSSSGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAKTLRN
DNSSRFGKLIEIHFSESGKISGAQIQTFLLEKSRVVQCAEGERSYHIFYQLCAGASPALREKLNLTSAHEYKYLGQSNCY
SINGVDDAERFHTVKEALDIVHVSKEDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADESFLFHSLGSWCWKQECLLH
NMCLSTVAKLIGCNINELTLTLSKRNMRVRNDTIVQKLTLPQAIDARDALAKSIYSCLFDWLVEQINKSLAVGKRRTGRS
ISILDIYGFESFDKNSFEQFCINYANERLQQHFNRHLFKLEQEEYIQDGIDWTRVDFEDNQNCLSLFEKKPLGLLSLLDE
ESTFPNGTDLTLANKLKQHLQSNSCFRGDKGKLFTVVHYAGEVTYETTGFLEKNRDLLHSDSIQLLSSCSCLLPQAFASS
MLIQSEKPVVGPLYKAGGADSQRLSVATKFKSQLFQLMQRLGNTTPHFIRCIKPNNIQSPGVYEQGLVLQQLRCCGVLEV
LCKGPYKRFFIIAILHQFNILPEMYQVGYTKLFFRTGQIGVLEDTRNRTLHGILRVQSSFRGYQARCLLKELKRGISILQ
SFVRGEKIRKEFAELRRRHKAAATIQSQVKSKIARIQYKGIADASVVIQSAIRGWLVRRCSGDIGWLKSGGAKTNELGEV
LVKASVLSELQRRVLKAEAALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSA
RNSDASVNASDATDWDSSSNQFRSQTSNGVGSRLQPMSAGLSVIGRLAEEFEQRAQVFGDDAKFLVEVKSGQVEANLDPD
RELRRLKQMFETWKKDYGGRLRETKLILSKLGSEESSGSMEKVKRKWWGRRNSTRY*

DNA
ATGTCTCAGAAGGTTACTCCATTCATGCAGTCACTTAAATCTTTGCCAGCAGACTATAGATTTGATGGTTCACCAGTCTC
TGACCGCCTTGAAAATTCTTCTGGTGCAAGTGTTCGCTTGACCAATTCGAATGTTCCAAGAAAAGGTGGCTTAAGGAATG
GTGTTAGTCGAACTGATACTGCTGCTGGGGATAGTGAGGATTCACCATATAGCGGGCACGGTGTTTTTGTTGAAGAGCAG
TCTTTAACGGATGATGTAGATTCTGGAGCTGCTACAATGCCCTTGCCTCAGAGTGATGAACGCAGGTGGAGTGACACTAG
TGCATATGCTCGAAAGAAGATACTGCAATCTTGGATTCAACTTCCAAATGGTAACTGGGAGCTTGGGAAGATATTGTCAA
CTTCAGGGGAGGAGTCTGTTATATCTTTGCCCGAAGGAAAAGTTATAAAAGTCATATCAGAGACTCTAGTACCTGCAAAT
CCTGATATTCTTGATGGAGTGGACGATCTTATGCAGCTTAGTTACTTAAATGAGCCATCAGTGTTGTACAACCTCAACTA
TAGGTACAACCAAGACATGATATATACAAAAGCAGGGCCAGTTTTGGTGGCTGTGAATCCTTTTAAGGAGGTTCCTTTAT
ACGGAAATCGATACATTGAAGCATACAGGAAGAAATCAAATGAGAGTCCTCATGTGTATGCAATTGCAGATACAGCAATT
CGCGAAATGATACGCGATGAAGTTAACCAATCTATCATTATCAGATGTATTTGTATTCATGAGTCCATGACCTATTCTAT
TTCTTCTTCCAGCGGCGAGAGTGGAGCAGGGAAAACTGAGACTGCTAAAATAGCTATGCAATACTTGGCTGCTCTTGGAG
GCGGAAGCGGGATCGAATATGAGATACTTAAGACTAATCCCATTTTGGAAGCATTTGGAAATGCAAAAACATTGAGAAAT
GATAATTCTAGTCGTTTTGGGAAGCTAATAGAGATTCATTTTAGTGAAAGTGGAAAGATATCGGGTGCTCAAATTCAAAC
CTTTTTACTAGAAAAGTCTAGAGTGGTCCAATGTGCTGAAGGGGAAAGGTCATATCATATTTTTTATCAACTTTGTGCTG
GGGCTTCACCTGCACTTAGAGAGAAGCTAAATCTGACAAGCGCCCATGAGTATAAATATTTGGGACAGAGTAATTGTTAT
TCAATTAACGGAGTTGACGATGCTGAACGTTTTCACACTGTTAAGGAAGCTCTGGACATTGTGCATGTTAGTAAAGAAGA
TCAAGAAAGTGTATTTGCAATGCTTGCTGCAGTTTTATGGCTGGGAAACGTTTCCTTCACCGTTATTGACAATGAAAACC
ATGTTGAACCTGTAGCAGATGAAAGTTTTTTGTTTCATTCTCTTGGGTCCTGGTGTTGGAAACAAGAATGTTTGCTGCAT
AATATGTGTTTGTCAACTGTTGCTAAATTGATTGGGTGCAACATCAATGAGCTTACGCTAACTTTATCGAAACGTAACAT
GAGAGTTAGGAATGATACCATTGTACAGAAGCTAACGCTACCACAGGCCATTGATGCAAGAGATGCTTTAGCAAAATCAA
TCTATTCGTGCCTGTTTGACTGGCTGGTTGAACAGATCAACAAATCTCTTGCTGTGGGAAAGAGGCGAACTGGCAGATCT
ATCAGTATTCTTGATATCTACGGCTTTGAATCATTTGATAAAAATAGCTTCGAGCAGTTCTGTATAAATTATGCAAATGA
GAGATTGCAGCAACACTTTAACCGTCATCTATTCAAGCTGGAGCAAGAGGAATATATCCAGGATGGCATTGACTGGACAA
GGGTTGATTTTGAGGACAACCAAAATTGTCTGAGTCTTTTTGAAAAGAAACCATTGGGGCTGCTCTCCCTTTTGGATGAG
GAATCTACATTTCCGAATGGCACAGATTTGACACTTGCAAACAAGCTAAAACAGCATCTACAGTCTAATTCATGTTTCAG
AGGAGATAAAGGGAAGCTTTTCACAGTTGTGCATTATGCAGGAGAGGTTACATATGAGACGACTGGATTTCTAGAGAAGA
ATAGAGACTTGTTGCATTCGGATTCTATTCAACTTTTGTCCTCTTGTTCTTGCCTCCTTCCTCAAGCATTTGCTTCTAGC
ATGCTGATCCAATCTGAAAAACCCGTTGTGGGTCCTTTATACAAAGCAGGTGGTGCTGATTCCCAGCGTTTGAGTGTAGC
TACTAAATTTAAGAGTCAACTCTTCCAATTGATGCAACGTTTAGGAAACACTACCCCACATTTCATTCGCTGTATCAAGC
CAAATAACATCCAGTCTCCCGGGGTGTATGAGCAAGGGCTTGTTTTACAGCAGCTAAGATGTTGTGGGGTCCTAGAAGTG
TTGTGCAAGGGACCGTACAAGCGTTTCTTCATAATTGCGATTCTCCATCAGTTTAATATCTTGCCGGAGATGTATCAAGT
TGGCTACACAAAGTTGTTTTTCAGAACTGGCCAGATTGGGGTTCTTGAGGACACAAGGAACCGTACTCTCCACGGCATTT
TACGTGTTCAAAGTTCTTTTAGAGGATACCAAGCACGCTGTCTCCTGAAGGAACTTAAAAGGGGAATTTCTATTCTCCAA
TCATTTGTTCGTGGAGAGAAGATAAGAAAAGAGTTTGCTGAGTTACGAAGGAGGCATAAGGCTGCTGCTACTATACAGAG
CCAAGTTAAAAGCAAGATTGCTAGGATACAGTATAAGGGCATAGCCGATGCATCAGTTGTGATACAATCAGCAATTCGTG
GTTGGTTGGTTAGAAGATGTTCAGGGGATATTGGATGGTTAAAATCTGGAGGTGCCAAGACAAATGAGTTAGGTGAGGTG
CTAGTGAAAGCATCAGTACTTTCCGAGCTCCAACGCAGGGTACTTAAAGCGGAAGCTGCTCTGCGTGAAAAGGAAGAAGA
GAACGACATTCTTCAGCAGAGGCTTCAACAATATGAGAACCGGTGGTCAGAGTATGAGACAAAGATGAAATCAATGGAAG
AAATCTGGCAAAAGCAAATGAGGTCGTTGCAGTCCAGTCTTTCCATAGCAAAGAAAAGCTTAGCTGTTGAGGACTCAGCG
AGAAACTCAGATGCATCTGTCAATGCGAGTGATGCAACAGATTGGGATTCAAGCAGTAATCAGTTCAGGAGCCAAACAAG
CAATGGAGTAGGGTCAAGACTACAGCCTATGAGCGCAGGGCTGAGCGTGATTGGGCGGTTAGCAGAAGAATTCGAGCAGA
GAGCTCAAGTGTTTGGTGATGATGCAAAGTTCTTGGTGGAAGTGAAATCTGGTCAGGTGGAAGCAAACTTGGACCCAGAC
AGAGAACTGAGGAGGCTGAAACAGATGTTTGAGACGTGGAAAAAGGATTATGGAGGGAGATTGCGGGAAACGAAACTGAT
ACTGAGCAAGCTCGGGAGCGAAGAGAGCAGTGGTTCGATGGAGAAAGTGAAGAGGAAGTGGTGGGGAAGGAGAAATAGCA
CCAGGTATTGA