Details for Arabidopsis Locus AT3G19950

Position : Chr3 ( 5`- 6942769 .. 6945224 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19950

Protein [Map View]
MSSGVNSTGSAAAAPEVDKMFFCYQCNQTVTISISSSADPFCPICNQGFLEEYEDPNPNQSLNFNPNSSDSFFPMADPFS
TLLPLIFGSSAAAPSGMDFMSLFGPSMQPQARSTQQNPQSDAFDPFTFLQNHLQTLRSSGTHFEFVIENHPSDPGNRMPG
NFGDYFFGPGLEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQ
DCLLPWLELHNSCPVCRFELPTDDPDYENRSQGSQGSGDGQGSVEGQQTPRFSIQLPWPFRRQDGSGSGSGAPGTGGGNL
ETRGEDLD*

DNA
ATGTCTTCCGGCGTAAATTCAACTGGCTCCGCCGCAGCAGCACCGGAGGTTGACAAGATGTTCTTCTGCTACCAGTGCAA
TCAAACAGTCACAATCTCAATTTCCTCATCCGCTGATCCTTTTTGTCCAATTTGTAACCAAGGGTTTCTTGAAGAATACG
AAGACCCTAACCCTAATCAATCCCTCAATTTCAACCCTAACTCTTCTGATTCCTTTTTCCCCATGGCCGATCCTTTCTCC
ACCTTGCTCCCGCTCATATTCGGCTCTTCCGCTGCCGCTCCTTCCGGCATGGACTTCATGAGCTTATTCGGTCCTTCGAT
GCAACCACAGGCTCGTTCCACTCAGCAGAATCCTCAGTCTGACGCGTTTGATCCGTTTACGTTTCTTCAGAATCATCTCC
AGACTTTGCGATCTAGCGGTACGCACTTTGAGTTCGTGATCGAGAATCATCCTTCGGATCCAGGTAATCGTATGCCTGGG
AATTTCGGTGATTACTTCTTTGGTCCAGGTCTTGAGCAGTTGATTCAGCAACTAGCTGAGAATGATCCTAATCGTTACGG
AACTCCTCCTGCTTCCAAATCCGCCATTGATGCTCTTCCTACTGTTAAGGTAACGAAGGATATGTTGAAATCGGAGATGA
ACCAATGCGCGGTGTGTATGGATGAGTTTGAGGATGGTAGCGATGTTAAGCAGATGCCTTGTAAGCACGTCTTTCATCAG
GACTGTTTGCTCCCTTGGCTGGAGTTGCATAATTCGTGTCCTGTTTGTCGATTCGAGTTGCCTACGGATGATCCTGATTA
TGAGAACAGGAGTCAAGGAAGTCAGGGGAGTGGTGATGGACAAGGATCGGTTGAGGGTCAGCAGACGCCGAGGTTTAGTA
TACAACTTCCTTGGCCGTTCAGGAGACAAGATGGCTCTGGTTCAGGCTCGGGAGCACCTGGTACTGGTGGAGGTAATCTT
GAGACCAGGGGTGAAGATTTGGATTGA