Details for Arabidopsis Locus AT3G19920

Position : Chr3 ( 5`- 6929711 .. 6931806 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19920

Protein [Map View]
MSSSRELQYLEYTYRNNRPTTGLLNSIFMTTVNTAARSLVSVASTASTPEIPSRRWSASDHLSFASGLLTTAAENALVPA
KASSSSSTSSTALVKYSGSSDLGMMICDGVDEPSVNSLGRALCHALALMNEIPVTSRKYQFAMGMAEKIMEDNAQSGHVD
LLDVNRAALASSFARTTARLQDCLKRSRTADEPFGGLPLRVVSALPLGGYVASYVRGLSACINTVRSLADMTGNLLSQTR
RRESAVVRAGGIQENEAELAVEKLAEELLWMTEKLRRYGAVAEGIKRWSYASGLASLSLTAAPRVQGLMVKISALLIGEL
ARDSTQVPGQVTFRLLANWLPLFSHARNGLAFPVLTGYERVEVERAIDKAISTLPALDQEILLTNWLQDFSVSASEWPNL
QPAYDRWCHSTRQLFM*

DNA
ATGTCGTCGTCGAGGGAGCTACAATACTTGGAGTACACATACAGAAACAACCGTCCCACGACGGGTCTCCTCAACTCCAT
CTTCATGACCACCGTCAACACGGCCGCTCGTTCTCTCGTCTCCGTCGCTTCCACCGCCTCTACACCAGAGATTCCTTCTA
GGCGATGGTCGGCTTCGGACCACCTCAGTTTCGCTTCGGGTCTTCTTACCACGGCTGCGGAGAACGCGTTGGTCCCGGCT
AAGGCTTCCTCGTCGTCGTCCACGTCATCAACTGCGTTGGTGAAGTATTCAGGGTCGTCAGATTTGGGTATGATGATTTG
CGACGGCGTTGATGAGCCTTCTGTTAACTCTCTCGGTAGAGCTCTTTGTCACGCATTAGCGCTTATGAACGAGATTCCAG
TAACCTCAAGAAAATATCAATTTGCCATGGGAATGGCTGAGAAGATCATGGAAGACAACGCTCAGAGCGGCCACGTGGAT
TTACTAGACGTCAACAGAGCGGCCCTAGCTTCCTCCTTTGCGCGCACTACTGCGCGATTGCAGGACTGCTTGAAACGCTC
TCGAACCGCTGACGAGCCCTTCGGTGGTTTGCCTTTGCGTGTGGTCAGCGCCCTCCCTCTGGGCGGCTACGTTGCCTCCT
ACGTGAGAGGGTTAAGTGCATGTATCAACACCGTCAGGTCCTTAGCAGACATGACTGGGAACTTGTTATCGCAGACTAGG
AGGAGAGAGTCTGCGGTGGTGAGAGCGGGTGGTATCCAAGAAAATGAGGCTGAACTAGCGGTCGAGAAGCTTGCGGAGGA
GCTGCTGTGGATGACAGAGAAGCTTAGGCGTTATGGTGCGGTGGCAGAAGGGATTAAGCGGTGGAGCTACGCTTCCGGTT
TAGCTTCCTTGTCTCTCACGGCTGCTCCCAGGGTTCAAGGCCTCATGGTTAAGATTTCGGCGCTCTTAATTGGAGAGTTA
GCAAGAGACAGCACACAAGTTCCAGGACAAGTGACATTCAGGCTCCTTGCAAACTGGCTCCCACTGTTTAGTCACGCAAG
GAACGGGCTTGCGTTTCCCGTACTGACGGGTTATGAGAGAGTTGAGGTGGAACGAGCCATAGACAAAGCCATCTCGACTT
TACCTGCATTGGACCAAGAAATCTTACTCACTAACTGGCTCCAAGATTTCTCAGTCTCGGCCTCCGAGTGGCCCAATCTT
CAGCCAGCATATGACCGTTGGTGCCACTCCACTCGCCAACTTTTCATGTAG