Details for Arabidopsis Locus AT3G19910

Position : Chr3 ( 5`- 6926308 .. 6929567 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19910

Protein [Map View]
MPMENDNGPHVGNVVVTAEQATKINETDGRLPENRQTGVVSDTGSGSERGEQGVGESAVAVAVPVEESGSISVGELPAPR
SSSARVPFTNLSQIDADLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYDEDEFDDPENEDEDDDEDEYETDDDPQ
EDGLDVNVHANEDDQEDDGNSDIEEVAYTDDEAYARALQEAEERDMAARLSALSGLANRVVEDLEDESHTSQDAWDEMDP
DELSYEELLALGDIVGTESRGLSADTIASLPSKRYKEGDNQNGTNESCVICRLDYEDDEDLILLPCKHSYHSECINNWLK
INKVCPVCSAEVSTSTSGQS*

DNA
ATGCCCATGGAGAACGACAATGGCCCACACGTTGGCAACGTCGTCGTCACCGCTGAGCAAGCGACCAAGATTAACGAGAC
TGATGGACGGTTGCCGGAGAATCGGCAGACCGGTGTTGTCTCTGACACCGGAAGTGGTAGCGAGAGAGGAGAGCAAGGGG
TTGGAGAGTCGGCAGTTGCTGTGGCGGTGCCGGTGGAGGAGAGCGGATCGATTTCGGTGGGAGAGCTACCTGCTCCCCGA
TCTTCCTCTGCTAGAGTTCCGTTTACTAATCTAAGCCAAATTGATGCGGATCTTGCTCTTGCTCGCACACTCCAAGAACA
GGAGCGGGCGTATATGATGTTGACCATGAATAGTGAAATCAGTGACTATGGGAGCTGGGAAACTGGAAGCTATGTATACG
ATGAGGATGAGTTTGATGACCCCGAGAATGAGGATGAGGATGATGATGAAGATGAATATGAAACAGATGATGATCCTCAG
GAAGATGGGCTTGATGTCAATGTGCACGCCAATGAAGATGATCAAGAAGATGACGGTAACTCTGACATTGAAGAAGTTGC
TTATACAGATGATGAGGCCTATGCTAGAGCTCTTCAAGAAGCTGAAGAAAGGGATATGGCTGCTAGATTGTCTGCCTTAT
CTGGGTTAGCAAACCGGGTGGTTGAAGATCTAGAGGATGAGAGTCATACTTCTCAGGATGCCTGGGATGAGATGGATCCT
GATGAGCTTTCATATGAGGAGTTGCTTGCACTTGGCGACATTGTGGGAACCGAAAGTAGAGGATTGTCTGCTGATACAAT
TGCATCTTTGCCTTCAAAAAGATATAAAGAAGGAGACAATCAGAACGGAACCAATGAGTCATGTGTTATATGTCGTTTAG
ACTATGAGGATGACGAAGACCTGATACTGCTCCCATGCAAACATTCTTACCACTCGGAGTGCATAAACAACTGGTTGAAG
ATAAACAAGGTTTGCCCCGTATGCAGTGCAGAAGTTTCAACTTCGACCTCTGGACAAAGCTGA