Details for Arabidopsis Locus AT3G19900

Position : Chr3 ( 5`- 6922567 .. 6925066 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19900

Protein [Map View]
MMSIVSSHHHCQQSVIHERSGIGTISKVSCSRYCGPCFSGRLAFSHSLCLKTTYGKTDRRKFSRICSIVDDEGNLDNSDD
EEKESLDDKTKRQANDMNRANLERMVGSDDSAFNGLDLATLIRQKYGKSYDVQLIKKEFMGKNLLAMNVMWKYREQRSFP
LTEEEYILRLDDVANMLKCWGAVSHIRSSLAKSKERPRIGKAVSIFIDMDSTGGRANEWIYK*

DNA
ATGATGAGCATTGTATCAAGTCATCATCACTGTCAACAATCTGTTATACACGAACGTAGCGGTATAGGAACAATATCTAA
GGTTTCTTGTTCGAGATATTGCGGTCCGTGTTTCTCTGGACGACTGGCTTTCTCTCATAGCCTCTGCTTGAAGACTACTT
ATGGGAAAACTGATAGGAGAAAGTTTTCAAGAATTTGCAGTATTGTGGATGATGAGGGGAATCTAGATAATTCGGATGAC
GAGGAAAAGGAATCACTCGATGATAAAACTAAAAGGCAAGCGAATGATATGAATCGGGCTAATCTTGAAAGAATGGTTGG
GTCAGATGATTCTGCATTTAACGGCTTAGATCTTGCAACCCTCATCAGACAGAAGTATGGAAAATCTTATGATGTTCAAC
TCATCAAGAAGGAGTTCATGGGGAAGAATCTTCTTGCAATGAATGTCATGTGGAAGTACAGAGAACAGAGGTCTTTTCCT
CTAACCGAAGAAGAATATATACTTAGACTTGACGATGTAGCCAACATGTTGAAATGCTGGGGAGCAGTCTCACATATCCG
TAGCAGCCTAGCAAAGTCGAAGGAGCGACCTCGGATAGGGAAGGCTGTCAGCATTTTCATAGACATGGATTCGACAGGGG
GAAGAGCAAATGAATGGATTTACAAGTAA