Details for Arabidopsis Locus AT3G19860

Position : Chr3 ( 5`- 6903833 .. 6906128 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19860

Protein [Map View]
MGIRENGIMLVSRERERARRLENRESIFAEPPCLLLAHRISPSPSILPAEEEVMDVSARKSQKAGREKLRREKLNEHFVE
LGNVLDPERPKNDKATILTDTVQLLKELTSEVNKLKSEYTALTDESRELTQEKNDLREEKTSLKSDIENLNLQYQQRLRS
MSPWGAAMDHTVMMAPPPSFPYPMPIAMPPGSIPMHPSMPSYTYFGNQNPSMIPAPCPTYMPYMPPNTVVEQQSVHIPQN
PGNRSREPRAKVSRESRSEKAEDSNEVATQLELKTPGSTSDKDTLQRPEKTKRCKRNNNNNSIEESSHSSKCSSSPSVRD
HSSSSSVAGGQKPDDAK*

DNA
ATGGGGATAAGAGAAAATGGAATAATGCTTGTGAGCAGAGAGAGAGAGCGAGCGAGGAGGCTAGAGAATCGAGAATCGAT
CTTCGCCGAACCACCTTGTCTTCTCTTAGCTCATCGAATCTCTCCGTCGCCGTCGATTCTTCCCGCCGAAGAGGAGGTCA
TGGACGTTTCTGCTAGAAAGTCACAAAAAGCTGGGCGCGAAAAGTTGAGGAGGGAAAAACTGAATGAGCATTTTGTTGAA
CTGGGAAATGTACTCGATCCAGAGAGACCCAAGAATGACAAAGCCACGATTCTGACTGATACTGTTCAGTTGTTGAAAGA
GCTCACATCTGAAGTCAACAAACTGAAATCTGAGTACACCGCATTGACAGATGAGTCCCGCGAGTTGACACAGGAGAAAA
ACGACCTGAGAGAAGAAAAGACATCGCTGAAATCAGATATAGAGAATCTCAATCTTCAATACCAGCAGAGATTAAGGTCA
ATGTCTCCATGGGGAGCTGCGATGGATCACACAGTCATGATGGCTCCACCACCCTCCTTTCCATACCCTATGCCTATTGC
TATGCCTCCCGGGTCAATCCCAATGCATCCATCAATGCCATCTTACACATACTTTGGGAACCAGAACCCTAGCATGATCC
CAGCTCCATGTCCTACATACATGCCCTACATGCCTCCTAATACAGTCGTTGAGCAACAATCCGTGCACATTCCACAGAAC
CCCGGTAACCGTTCTCGGGAACCTAGAGCAAAGGTTTCAAGAGAGAGCAGATCTGAGAAAGCAGAGGACTCCAACGAAGT
TGCAACACAACTCGAATTAAAAACCCCTGGATCTACTTCTGATAAGGATACATTGCAAAGGCCAGAGAAGACAAAGAGAT
GTAAGAGAAACAACAACAACAACTCAATAGAAGAAAGCTCTCATTCTAGCAAGTGTTCATCTTCTCCGAGCGTACGAGAC
CACAGTTCTTCCAGTAGCGTAGCTGGTGGCCAAAAACCTGATGATGCAAAATGA