Details for Arabidopsis Locus AT3G19820

Position : Chr3 ( 5`- 6879617 .. 6882315 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19820

Protein [Map View]
MSDLQTPLVRPKRKKTWVDYFVKFRWIIVIFIVLPFSATFYFLIYLGDMWSESKSFEKRQKEHDENVKKVIKRLKGRDAS
KDGLVCTARKPWIAVGMRNVDYKRARHFEVDLGEFRNILEINKEKMTARVEPLVNMGQISRATVPMNLSLAVVAELDDLT
VGGLINGYGIEGSSHIYGLFADTVEAYEIVLAGGELVRATRDNEYSDLYYAIPWSQGTLGLLVAAEIRLIKVKEYMRLTY
IPVKGDLQALAQGYIDSFAPKDGDKSKIPDFVEGMVYNPTEGVMMVGTYASKEEAKKKGNKINNVGWWFKPWFYQHAQTA
LKKGQFVEYIPTREYYHRHTRCLYWEGKLILPFGDQFWFRYLLGWLMPPKVSLLKATQGEAIRNYYHDMHVIQDMLVPLY
KVGDALEWVHREMEVYPIWLCPHKLFKQPIKGQIYPEPGFEYENRQGDTEDAQMYTDVGVYYAPGCVLRGEEFDGSEAVR
RMEKWLIENHGFQPQYAVSELDEKSFWRMFNGELYEECRKKYRAIGTFMSVYYKSKKGRKTEKEVREAEQAHLETAYAEA
D*

DNA
ATGTCGGATCTTCAGACACCGCTTGTGAGGCCCAAGAGGAAGAAGACTTGGGTTGATTACTTTGTCAAGTTCAGATGGAT
CATTGTCATCTTCATCGTCCTTCCATTCTCAGCCACATTCTACTTCCTCATCTACCTCGGGGACATGTGGTCAGAGTCCA
AGTCCTTTGAGAAACGTCAGAAGGAACACGACGAGAATGTCAAGAAAGTCATCAAAAGGCTTAAGGGTAGGGATGCTTCC
AAGGACGGGCTTGTCTGCACTGCTCGTAAGCCCTGGATCGCTGTTGGAATGAGGAACGTTGACTACAAGAGAGCCCGGCA
TTTCGAGGTTGACTTGGGGGAGTTCCGTAACATCCTTGAGATCAACAAGGAGAAGATGACTGCTAGAGTGGAGCCTCTTG
TTAACATGGGACAGATTTCCCGTGCTACCGTCCCAATGAACCTGTCTCTCGCTGTTGTTGCTGAGCTTGATGACCTTACC
GTTGGTGGACTTATCAATGGATATGGTATTGAAGGAAGCTCTCACATCTACGGTTTGTTTGCTGATACCGTTGAGGCTTA
CGAGATTGTTCTTGCGGGTGGAGAGCTTGTCCGCGCCACAAGGGATAATGAGTATTCTGATCTTTACTACGCAATCCCGT
GGTCGCAAGGAACTCTTGGACTCCTTGTAGCTGCTGAGATCAGGCTTATTAAAGTCAAGGAGTACATGAGACTCACTTAC
ATACCAGTCAAGGGTGATCTTCAAGCCTTAGCTCAAGGTTACATTGATTCTTTTGCTCCCAAAGACGGTGACAAGTCGAA
AATCCCGGATTTCGTCGAAGGCATGGTTTACAATCCAACGGAAGGAGTGATGATGGTTGGAACATATGCATCTAAAGAAG
AGGCAAAGAAGAAAGGGAACAAAATCAACAATGTGGGATGGTGGTTCAAGCCGTGGTTCTACCAGCACGCGCAGACCGCC
CTGAAAAAGGGACAGTTTGTTGAGTACATCCCAACTCGTGAATACTACCACAGGCACACAAGGTGCTTGTACTGGGAAGG
GAAGCTTATTCTTCCATTTGGTGATCAGTTCTGGTTTAGGTACCTCTTAGGTTGGTTGATGCCTCCAAAGGTCTCTCTTC
TTAAGGCCACTCAAGGTGAAGCTATCAGGAACTATTACCATGATATGCATGTTATTCAGGATATGCTTGTTCCTCTTTAC
AAGGTTGGCGATGCACTCGAATGGGTCCACCGCGAAATGGAGGTGTATCCAATTTGGCTTTGCCCACACAAACTCTTCAA
GCAGCCAATCAAAGGCCAAATCTACCCAGAGCCAGGCTTCGAGTACGAAAACAGACAAGGAGACACAGAAGATGCACAGA
TGTACACTGATGTTGGAGTCTACTACGCACCTGGCTGTGTCCTAAGAGGTGAAGAGTTTGATGGATCAGAAGCAGTGCGT
AGGATGGAGAAATGGCTGATAGAGAACCATGGATTCCAGCCTCAGTACGCGGTGTCTGAGCTCGACGAGAAGAGCTTCTG
GAGAATGTTTAATGGTGAATTGTATGAGGAGTGCCGCAAGAAGTATAGAGCTATTGGAACGTTCATGAGTGTTTACTACA
AGTCCAAGAAAGGAAGGAAGACTGAGAAAGAAGTTAGAGAAGCCGAACAAGCTCATCTCGAAACTGCTTATGCCGAGGCA
GATTAA