Details for Arabidopsis Locus AT3G19810

Position : Chr3 ( 5`- 6877575 .. 6879399 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19810

Protein [Map View]
MSLVCSLSCVAPLPQTKQSRPSFLKLETCTLSLSSPAGYPNFTTGIRKHISYLFTEPIKLPRLAKSRILVSQESFTETST
IDMDWEDQEEIEDTGSPWEGSVMYRRNASVTHVEYCTTLERLGLGRLSTDVSKKRASAMGLRVTKDVKDYPDGTPVQVSV
DVIRKKKKLRLDGIVRTVITLGCNRCGESTGESIFSNFSLLLTEEPVEEPDVIDLGFTFGNDKEEGEDDDDNDDSWIDWE
DKLHFPPEVKEIDISKHIRDLVHLEITITAICDSACKGMCLKCGANLNKRKCDCGREEKDKGYGPLGNLREQMQQKEGLR
N*

DNA
ATGTCTCTGGTTTGCTCTTTATCTTGTGTAGCTCCCTTGCCACAGACTAAACAGTCGCGTCCAAGTTTTCTGAAACTCGA
AACATGTACCTTAAGTTTATCTTCTCCCGCTGGCTATCCTAATTTTACCACCGGTATTAGGAAGCATATCAGTTACTTGT
TCACTGAACCGATCAAGCTTCCTAGGCTAGCAAAGAGTCGGATATTAGTTAGTCAGGAGTCTTTTACAGAGACCAGCACA
ATAGATATGGATTGGGAAGATCAGGAGGAAATTGAGGATACTGGGTCACCTTGGGAAGGTTCGGTTATGTATAGGAGAAA
TGCTTCAGTTACACATGTTGAATATTGCACTACCTTAGAGAGGCTTGGGTTGGGAAGGTTGTCAACAGATGTCTCGAAGA
AGAGAGCTTCTGCAATGGGACTTAGAGTGACAAAAGATGTCAAGGATTATCCAGATGGCACACCAGTTCAAGTTTCGGTT
GATGTCATAAGGAAGAAGAAGAAGCTGAGACTTGATGGAATTGTCAGGACTGTTATCACACTCGGCTGCAACAGATGTGG
TGAGTCAACAGGTGAGAGCATCTTCTCCAACTTCTCGCTATTACTAACCGAAGAGCCAGTTGAAGAACCCGATGTCATTG
ATCTAGGATTCACATTCGGTAATGACAAAGAAGAAGGCGAAGATGATGATGATAATGATGATTCATGGATAGATTGGGAG
GATAAGCTTCATTTTCCACCTGAGGTGAAAGAAATAGATATCTCAAAGCATATAAGAGACTTGGTGCATTTAGAAATCAC
CATCACTGCGATATGCGATTCTGCATGTAAAGGAATGTGCTTGAAGTGTGGTGCGAATCTGAATAAGAGGAAATGTGATT
GTGGCAGAGAAGAGAAGGATAAAGGATATGGACCTCTCGGAAATCTTAGAGAGCAAATGCAACAAAAAGAGGGACTAAGG
AACTAA