Details for Arabidopsis Locus AT3G19790

Position : Chr3 ( 5`- 6874603 .. 6875856 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19790

Protein [Map View]
MVISQEEADNDHASGSKGSSVGENSLDSIESEEHDDDMSDASGSEESSDEENLVDSLMSEMINEWYDEMYDDLTDGLDDI
LAARIPSLSALRTSNKQPSDSNKTSIVFDSMKALHDLPGVRMWSPLYRASLTHFQADVTHREAFLAFSDPEDKICYLENK
TGKKRDE*

DNA
ATGGTTATTTCTCAAGAGGAAGCTGACAATGATCATGCAAGCGGATCGAAAGGATCAAGCGTTGGGGAAAACAGTTTGGA
TTCTATAGAGTCTGAAGAGCATGATGATGATATGTCTGATGCGAGCGGATCGGAAGAATCAAGCGATGAAGAAAACCTTG
TGGATTCTCTAATGTCTGAAATGATTAATGAGTGGTATGATGAGATGTATGATGATTTAACAGACGGACTCGATGATATT
CTTGCTGCTAGAATCCCTTCACTTAGCGCTCTACGAACCAGCAATAAGCAACCCTCAGATTCCAACAAGACTAGTATTGT
GTTTGATTCAATGAAGGCACTCCATGATCTACCTGGTGTTAGGATGTGGTCGCCTTTATACCGTGCATCGTTGACTCATT
TTCAGGCTGATGTTACTCATAGAGAGGCCTTCTTGGCATTTTCTGATCCTGAGGATAAGATTTGCTACTTAGAGAACAAG
ACTGGCAAAAAGAGAGATGAATGA