Details for Arabidopsis Locus AT3G19780

Position : Chr3 ( 5`- 6870173 .. 6874850 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19780

Protein [Map View]
MKTPTLLLLPFLVFVSIILPSSCHGEWEILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYEITQMVQRREEFGLLKLM
VVYRNSEKVLAQAIGAAVNGITILYYHNSVPYNYLGKLRASNILSSIHPYLTSTPEELPLKHLKSPKSLKDFLQSSDKAL
LLFEFCGWTTTLMSELKKNVTQDNLWQEWNNMCGLQSGFGKVPWLEDFSYANDTAALQEHGRVNLGLGQTCNHEEFKRFS
SFLLKLIATTKEFSLPPERQKFGLITEESLASSFNFGKSDSWAAVLQLAGCPHCSKIFKAGDDIQRFLKMENPIVTELED
DWQDHESSLPASKPSVILFVDRSSGSLEEMRRSIKALDTFRQVAAQHKLSDIKKWENDIMYENPVSQTDQESGSVPLPKT
VQKFKKIKFENKVSFMIMDGGKHVALDTIAPGMEGSSLQEILKNLLHRRKESKLSSIAKDVGFRLLSDDVHIKVLDALPS
QAEVVSGQDTTSSSAEGSSEISLHPTEADVQNRVSMSSEAKDEMKSSEIESSSPSDEEQATTNRSEQLVVAETDKTEVYL
KDNVNGEIKVSLHSEPKEDLVHKFTGSFFFSDANYVLLRALTGDVKIPSAVIIDPALQQHYVLQDKFSYSSLVDFLDGYL
NGSLSPYAQSESSIQTPKRAAVPPFVNLDFHEVDSIPRVTVSTFSHMVHAWDQSSAEKAPCPLCQDVLVFFSNTWCGFCQ
RMELVLHEVYRSLKEYKAIIQGGSRNNQRSELAETPTNGENLKSPLIYLMDCTLNDCSLILKSINQREVYPSLILFPAER
NKVTPYEGESSVTDITEFLARHANNSREFFRLLPTLSRNGRRNSNKVDQSSSSAVNNKVTDGDKLVEVVLRNREPAEREV
NHDQVNSQSPPIHSLTNAPQVKTGTVLVATEKLAASLTFAKSKILIIKAGPEIGFLGLIFNKRIRWKSFPDLGETAELLK
ETPLSFGGPVVDPGIPLLALTRERDSSTNHDHPEISPGVYFLDHQSVARRIQELKSRELNPSEYWFFLGYSSWSYEQLFD
EIGLGVWDVDNSDIDFAWP*

DNA
ATGAAAACGCCGACGCTCCTCCTCCTTCCATTCTTGGTCTTCGTATCCATAATTCTTCCCTCAAGCTGCCATGGCGAATG
GGAAATCCTCACGGAGCAAAACTTCTCTTCTCAGATCCGTCTCCACCCTCACGTCCTCCTCTTTGTCACCACTCCATGGT
GTGGTGAGTCCAGATCTCTTAAGTATGAAATTACTCAGATGGTTCAGAGAAGAGAAGAGTTTGGCTTGTTGAAGTTAATG
GTTGTATACAGAAACTCAGAAAAGGTGTTAGCACAAGCCATTGGTGCTGCTGTCAATGGGATAACAATTTTGTACTATCA
CAATAGTGTGCCTTACAACTATCTAGGGAAACTCCGAGCCTCGAATATATTGTCATCTATTCATCCTTATCTGACATCTA
CGCCTGAAGAACTCCCTCTCAAACATTTGAAGTCTCCAAAGAGTTTGAAAGATTTCCTTCAATCATCTGATAAGGCTTTA
CTTCTGTTCGAATTTTGCGGATGGACAACTACACTGATGTCTGAGCTGAAGAAAAATGTTACTCAAGATAACCTTTGGCA
GGAATGGAACAATATGTGTGGACTCCAAAGTGGATTTGGTAAAGTTCCCTGGCTTGAGGATTTTAGCTATGCGAATGATA
CTGCTGCTTTGCAGGAACATGGCAGGGTAAATCTGGGTCTTGGACAGACATGTAACCATGAAGAGTTCAAGCGATTTAGT
TCATTCCTCTTGAAATTGATTGCCACCACAAAAGAGTTTTCTCTGCCTCCGGAAAGGCAAAAATTTGGTCTGATCACAGA
AGAATCATTGGCTTCATCATTTAATTTTGGAAAATCTGATTCGTGGGCAGCGGTCCTTCAGCTGGCAGGATGTCCACATT
GTTCTAAGATTTTCAAGGCCGGGGATGACATTCAGAGATTTTTAAAGATGGAAAATCCGATAGTTACAGAGCTGGAGGAC
GACTGGCAGGACCATGAGTCATCTCTACCTGCAAGTAAACCGTCAGTTATTCTTTTTGTGGATAGATCAAGTGGGTCCTT
GGAGGAGATGAGAAGGAGTATAAAAGCACTTGATACCTTCAGACAGGTAGCTGCACAGCATAAATTGTCTGACATAAAAA
AGTGGGAGAATGATATTATGTATGAGAACCCCGTTAGTCAAACTGATCAAGAATCGGGGTCCGTGCCACTTCCGAAAACT
GTCCAAAAGTTTAAGAAAATTAAGTTCGAGAATAAGGTTTCTTTTATGATTATGGATGGGGGTAAACATGTAGCCCTAGA
TACTATAGCGCCAGGTATGGAAGGCAGTTCCCTGCAGGAGATACTGAAAAATCTTCTTCACAGAAGAAAAGAAAGTAAAT
TGAGCTCAATTGCTAAGGATGTTGGTTTCCGTCTGTTATCTGATGATGTGCACATAAAAGTTCTGGATGCGTTACCGTCA
CAAGCAGAAGTTGTGTCTGGTCAAGATACAACTTCATCTTCTGCAGAAGGTTCCAGTGAAATTTCACTTCACCCTACAGA
AGCAGATGTGCAGAACAGAGTCAGTATGAGTTCTGAAGCAAAAGATGAAATGAAATCCTCTGAAATTGAATCCTCCTCCC
CTAGTGATGAAGAGCAGGCTACTACAAACAGGAGTGAACAATTAGTAGTGGCAGAAACCGATAAGACTGAGGTTTATTTG
AAAGACAATGTTAATGGAGAGATCAAGGTCTCGTTGCACTCAGAACCGAAGGAAGATCTAGTGCATAAATTCACGGGTTC
ATTTTTCTTCTCTGATGCAAATTATGTTTTACTTAGGGCCCTTACTGGTGATGTAAAGATTCCATCAGCAGTAATTATTG
ACCCTGCTTTACAACAGCACTATGTCCTTCAAGATAAGTTCAGCTATTCGTCACTGGTCGACTTTCTTGATGGATATCTC
AATGGAAGTCTATCTCCTTATGCACAGTCTGAATCTAGCATTCAGACGCCTAAAAGAGCTGCAGTTCCACCTTTTGTTAA
TCTGGATTTTCACGAGGTGGATTCTATTCCCCGTGTCACAGTCAGTACCTTCTCCCACATGGTTCATGCATGGGATCAAT
CCAGTGCAGAGAAGGCTCCTTGTCCTCTGTGCCAGGACGTTTTGGTCTTTTTTAGTAATACTTGGTGTGGGTTTTGTCAG
AGGATGGAGCTAGTTCTGCATGAAGTTTACCGATCATTAAAGGAATATAAAGCGATTATACAAGGAGGATCCAGGAACAA
TCAAAGATCTGAATTAGCAGAGACACCAACTAATGGCGAGAATCTAAAATCTCCACTTATCTATTTAATGGATTGCACGT
TGAATGATTGCAGCTTGATCCTAAAATCAATAAATCAGAGGGAAGTGTATCCTTCTCTGATATTATTTCCAGCCGAGAGA
AACAAAGTCACTCCATATGAAGGGGAGTCATCTGTAACTGACATAACAGAGTTTCTAGCTCGCCATGCGAATAACTCTCG
CGAGTTTTTCAGACTCCTTCCTACTCTGTCTAGAAATGGAAGAAGAAACTCAAACAAGGTGGATCAGTCTTCTTCATCTG
CGGTAAATAATAAAGTGACAGATGGTGATAAACTTGTTGAGGTCGTTTTAAGGAACAGAGAGCCCGCTGAAAGAGAGGTA
AACCACGACCAGGTCAATTCCCAATCGCCTCCAATACACTCGCTCACAAACGCTCCCCAAGTGAAAACTGGCACAGTCCT
GGTCGCTACAGAAAAGCTAGCTGCCTCCCTAACATTTGCCAAATCAAAGATTCTGATCATAAAAGCAGGCCCCGAGATCG
GTTTCCTGGGCCTAATCTTTAACAAACGGATAAGGTGGAAATCATTCCCTGACCTCGGTGAAACAGCCGAGCTCTTGAAA
GAGACTCCTCTATCGTTCGGAGGTCCTGTAGTGGATCCAGGAATACCACTATTAGCTCTGACCCGAGAGCGAGACTCTTC
CACAAACCATGATCACCCGGAAATCTCACCAGGCGTGTATTTCCTAGATCATCAATCTGTGGCCCGTCGAATCCAAGAGT
TGAAATCTAGAGAGCTAAATCCAAGTGAGTACTGGTTTTTCTTGGGATACTCAAGCTGGAGTTATGAGCAGTTGTTTGAT
GAGATCGGTCTTGGAGTGTGGGATGTTGATAACAGTGACATTGACTTTGCTTGGCCTTAG