Details for Arabidopsis Locus AT3G19760

Position : Chr3 ( 5`- 6863713 .. 6866593 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19760

Protein [Map View]
MATANPGRGGGRRGGGAMDDDKLVFETTDGIEPITSFNDMGIKEDVLRGVYEYGFEKPSAIQQRAVMPILQGRDVIAQAQ
SGTGKTSMIALSVCQVVDTSSREVQALILSPTRELATQTEKTIQAIGLHANIQAHACIGGNSVGEDIRKLEHGVHVVSGT
PGRVCDMIKRRSLRTRAIKLLILDESDEMLSRGFKDQIYDVYRYLPPDLQVCLVSATLPHEILEMTSKFMTEPVKILVKR
DELTLEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDYLSEKMRSHNFTVSSMHGDMPQKERDAIMNEF
RSGDSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIKILRDIEQYYSTQIDEM
PMNVADLI*

DNA
ATGGCGACAGCGAATCCTGGCCGTGGAGGTGGTAGAAGAGGCGGTGGAGCTATGGATGACGATAAGTTGGTCTTCGAGAC
TACCGATGGAATTGAGCCCATCACGAGCTTCAATGATATGGGCATTAAGGAAGATGTGCTTCGCGGTGTCTACGAATATG
GATTCGAGAAGCCTTCCGCGATTCAGCAGAGGGCTGTTATGCCGATTCTTCAAGGACGTGATGTTATTGCTCAAGCTCAG
TCCGGTACCGGGAAGACATCTATGATTGCTCTCTCCGTTTGTCAAGTCGTTGATACTTCTTCTAGAGAGGTTCAGGCCTT
GATATTATCCCCAACAAGAGAGCTGGCTACACAAACAGAGAAGACGATACAAGCTATTGGATTACATGCCAATATTCAGG
CACATGCTTGCATCGGTGGGAATAGTGTTGGAGAAGACATCAGGAAGCTGGAGCATGGTGTTCATGTTGTGTCTGGGACA
CCTGGTCGTGTCTGTGACATGATAAAGAGGAGAAGTCTTCGTACCAGAGCTATTAAACTTCTGATTCTTGATGAATCAGA
TGAAATGCTGAGCAGAGGGTTCAAGGACCAGATCTATGATGTTTACAGATATCTTCCACCAGATCTTCAGGTTTGCTTGG
TTTCTGCAACTCTTCCTCACGAGATTTTGGAGATGACATCCAAGTTTATGACAGAACCAGTGAAGATACTTGTGAAGCGT
GATGAGTTGACTCTTGAAGGAATCAAACAATTTTTTGTTGCTGTTGAGAAGGAAGAGTGGAAATTTGATACACTCTGTGA
TCTTTATGACACGCTTACTATCACTCAAGCTGTTATCTTCTGCAATACTAAACGAAAGGTGGATTATCTTAGTGAGAAAA
TGAGAAGTCACAACTTCACTGTCTCATCAATGCATGGAGACATGCCTCAGAAGGAGAGAGACGCCATCATGAATGAGTTT
CGGTCAGGTGATAGTCGTGTTTTGATAACAACAGATGTATGGGCACGTGGGATTGATGTGCAACAAGTTTCTCTTGTTAT
CAATTATGATCTCCCCAACAACCGTGAGCTCTACATCCATCGTATTGGGCGGTCTGGTCGATTCGGGCGTAAGGGTGTTG
CAATCAACTTTGTTAAAAGCGACGACATCAAGATTCTCAGAGACATTGAGCAGTACTACAGTACCCAGATTGATGAGATG
CCAATGAATGTAGCTGATCTTATCTAA