Details for Arabidopsis Locus AT3G19710

Position : Chr3 ( 5`- 6846969 .. 6849497 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19710

Protein [Map View]
MAPSAQPLPVSVSDEKYANVKWEELAFKFVRTDYMYVAKCNHGESFQEGKILPFADLQLNPCAAVLQYGQGLYEGLKAYR
TEDGRILLFRPDQNGLRLQAGADRLYMPYPSVDQFVSAIKQVALANKKWIPPPGKGTLYIRPILFGSGPILGSFPIPETT
FTAFACPVGRYHKDNSGLNLKIEDQFRRAFPSGTGGVKSITNYCPVWIPLAEAKKQGFSDILFLDAATGKNIEELFAANV
FMLKGNVVSTPTIAGTILPGVTRNCVMELCRDFGYQVEERTIPLVDFLDADEAFCTGTASIVTSIASVTFKDKKTGFKTG
EETLAAKLYETLSDIQTGRVEDTKGWTVEIDRQG*

DNA
ATGGCTCCTTCTGCGCAACCTCTTCCTGTGAGTGTTTCGGATGAAAAATATGCGAATGTCAAGTGGGAAGAGTTGGCATT
CAAGTTTGTTCGTACGGATTATATGTATGTTGCGAAGTGCAATCATGGAGAGAGTTTTCAAGAGGGGAAGATTCTTCCTT
TTGCTGATTTGCAACTTAACCCTTGCGCTGCTGTTCTTCAGTATGGCCAGGGTTTATATGAAGGACTGAAAGCTTACAGG
ACAGAAGATGGTCGGATTCTGCTATTCCGACCAGACCAAAACGGTCTCCGCCTTCAAGCCGGAGCTGACAGACTCTATAT
GCCTTATCCTTCGGTCGATCAATTCGTCTCCGCCATCAAACAAGTTGCTCTTGCCAACAAGAAATGGATTCCTCCTCCGG
GGAAAGGAACATTGTATATTAGGCCTATCTTGTTTGGGAGTGGTCCGATTCTTGGTTCATTTCCCATTCCTGAGACCACC
TTCACAGCTTTTGCCTGTCCTGTTGGACGTTATCATAAGGATAACTCTGGTTTGAATCTGAAAATCGAAGATCAGTTTCG
TCGAGCTTTTCCTAGTGGAACTGGTGGTGTGAAGAGCATCACAAACTATTGTCCTGTTTGGATACCATTGGCAGAGGCGA
AAAAACAAGGTTTCTCTGATATTTTGTTTTTGGATGCTGCAACTGGCAAAAACATTGAAGAACTTTTCGCAGCTAATGTT
TTTATGCTCAAGGGCAATGTTGTATCGACACCAACAATTGCAGGAACTATTTTGCCCGGAGTCACTCGAAACTGCGTAAT
GGAATTGTGTCGTGATTTCGGCTACCAGGTCGAGGAACGTACGATTCCTCTAGTGGACTTTCTCGATGCGGACGAAGCTT
TCTGTACTGGCACTGCTTCCATTGTGACTAGTATTGCATCCGTAACCTTTAAAGACAAAAAGACCGGATTCAAAACAGGG
GAAGAAACATTGGCTGCGAAGCTATACGAGACGTTAAGTGATATCCAGACGGGTCGGGTCGAGGATACCAAGGGATGGAC
GGTGGAGATTGACCGCCAGGGCTGA