Details for Arabidopsis Locus AT3G19690

Position : Chr3 ( 5`- 6842220 .. 6842856 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19690

Protein [Map View]
MSLLKTNILFLLAIALFYGSLAEDLQQQFLEAHNEARNEVGLDPLVWDDEVAAYAASYANQRINDCALVHSNGPFGENIA
MSSGEMSAEDAAEMWINEKQYYDYDSNTCNDPNGGTCLHYTQVVWKNTVRLGCAKVVCNSGGTFITCNYDPPGNYIGEKP
F*

DNA
ATGTCTCTACTCAAAACCAACATTTTATTTCTCTTAGCAATTGCTCTTTTCTATGGCTCTTTAGCCGAAGATTTGCAACA
ACAATTCTTAGAGGCCCACAACGAAGCCCGAAACGAGGTTGGGCTCGACCCATTGGTTTGGGACGATGAGGTCGCTGCAT
ATGCGGCAAGCTATGCAAACCAGAGGATCAATGATTGTGCATTAGTCCATTCGAATGGACCATTTGGAGAGAACATAGCG
ATGAGTAGTGGAGAAATGTCGGCTGAAGATGCTGCGGAAATGTGGATCAACGAGAAACAGTACTACGATTACGATAGTAA
CACGTGTAATGATCCAAACGGTGGCACCTGTCTACATTACACGCAAGTTGTTTGGAAAAACACAGTTCGTTTGGGATGTG
CTAAAGTTGTGTGTAACAGTGGTGGTACTTTTATTACATGCAACTATGATCCTCCTGGTAATTACATTGGTGAAAAACCA
TTCTAA