Details for Arabidopsis Locus AT3G19680

Position : Chr3 ( 5`- 6840281 .. 6842320 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19680

Protein [Map View]
MDPCSFVRIIVGNLAVRFPSSSSSSSSSSGPSVSGINPTAPNCYCKIRFKNFPREIVSVPVMFRTESESETRCSSSGNVS
TVAACFSLSKAQIEASLKKPKFSVLSVEAYSRGNSDGDDGVSGASCGLATAGEKLLGRFEVSLDLKSAETKSFLAHNGWV
ALPSKKTKSKTGSDPELHVSVRVEPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSNSGDRNLLHSSSMMSE
ISSTRSCISSMNSEKEQPSKERKGWSITVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLILRPDGCTWKPWGRLE
AWREAGYSDTLGYRFELFQDGIATAVSASSSISLKNGGSFVIDVTGGTSTTASTPTTSPQGSWDLGSGSSAGSRPASRPG
SGSGSDFGYLLPQHPSAAAQNRGFVMSATVEGVGKRSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDACRLFSHKLRK
ELRQQSQLGVV*

DNA
ATGGATCCGTGCTCTTTCGTACGGATCATAGTCGGTAACTTGGCCGTTAGGTTTCCGTCGTCGTCTTCTTCTTCTTCTTC
CTCATCAGGACCGTCTGTTTCCGGAATCAATCCAACGGCTCCTAACTGTTACTGTAAAATCAGATTCAAGAACTTTCCTC
GTGAGATTGTTTCTGTTCCGGTTATGTTCCGAACTGAATCTGAATCCGAGACTCGTTGCTCCTCCTCCGGTAACGTATCC
ACCGTTGCTGCTTGTTTCAGTTTAAGTAAAGCTCAGATCGAAGCGTCGTTGAAGAAACCTAAATTTAGTGTTCTCTCCGT
TGAGGCTTATTCCCGCGGAAATAGCGACGGAGACGACGGTGTTAGCGGCGCGTCGTGTGGACTCGCTACGGCGGGTGAGA
AGTTGCTTGGTCGATTTGAGGTTTCGCTTGATTTGAAATCGGCGGAGACGAAGAGTTTTTTGGCGCATAACGGTTGGGTT
GCTTTGCCGTCTAAGAAAACGAAGAGTAAAACTGGATCCGATCCGGAGCTCCACGTTAGCGTACGGGTCGAACCTGACCC
GAGATTCGTGTTTCAGTTCGACGGTGAGCCTGAGTGTAGTCCTCAGGTTTTTCAAGTTCAAGGAAACACAAAGCAAGCCG
TGTTCACTTGCAAATTCGGCTCTAGAAACTCCAACTCCGGTGATCGAAATCTTCTTCACAGTTCTTCGATGATGTCTGAG
ATAAGCTCAACGAGAAGTTGTATATCGTCGATGAATTCGGAAAAAGAACAACCGTCAAAAGAGAGAAAAGGATGGTCAAT
AACGGTCCATGATCTCTCCGGTTCACCCGTGGCTATGGCCTCTATGGTAACACCTTTCGTACCATCTCCTGGTTCGAACC
GGGTGACTCGGTCAAGTCCCGGAGCGTGGCTTATTCTTCGACCTGACGGTTGCACATGGAAGCCATGGGGAAGACTAGAA
GCATGGCGTGAGGCTGGTTACTCTGACACTCTAGGTTATCGTTTCGAGCTTTTCCAAGACGGTATAGCCACCGCAGTTTC
TGCATCGTCGTCGATCAGTTTGAAAAATGGCGGGAGTTTTGTTATTGATGTTACCGGCGGTACAAGCACAACGGCGTCTA
CGCCGACAACGAGTCCTCAAGGAAGCTGGGATCTCGGATCCGGTTCAAGCGCCGGTTCAAGACCCGCGTCGAGACCAGGA
TCAGGATCCGGGTCGGATTTCGGATATCTACTACCGCAACATCCGTCTGCGGCCGCGCAAAACAGAGGGTTCGTTATGTC
GGCTACGGTTGAAGGAGTTGGGAAACGAAGCAAACCAGAAGTAGAAGTCGGTGTGACGCACGTGACATGTACGGAGGATG
CAGCAGCGCACGTGGCATTAGCTGCGGCGGTGGATCTGAGTTTGGATGCTTGCAGGCTTTTCTCACACAAGCTAAGGAAA
GAGCTGAGACAGCAAAGCCAGCTTGGTGTCGTTTGA