Details for Arabidopsis Locus AT3G19670

Position : Chr3 ( 5`- 6828062 .. 6836582 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19670

Protein [Map View]
MANNHQYPGIQPFQHPNASSIDLPRGFAPPMNFQFLPTIQAPQSEQVARLSSQNFQCVGRGGTVLSIGYPPQSYAPQLLQ
SMHHSHERPSQLNQVQVQHVPLGPPTLISQPNVSIASGTSLHQPYVQTPDIGMPGFGGPRALFSYPSATSYEGSRVPPQV
TGPSIHSQAQQRASIIHTSAESSIMNPTFEQPKAAFLKPLPSQKALTDWVEHTSADGRKYFFNKRTKKSTWEKPVELMTL
FERADARTDWKEHSSPDGRKYYYNKITKQSTWTMPEEMKIVREQAEIASVQGPHAEGIIDASEVLTRSDTASTAAPTGLP
SQTSTSEGVEKLTLTSDLKQPASVPGSSSPVENVDRVQMSADETSQLCDTSETDGLSVPVTETSAATLVEKDEISVGNSG
DSDDMSTKNANQGSGSGPKESQKPMVESEKVESQTEEKQIHQESFSFNNKLEAVDVFKSLLKSAKVGSDWTWEQAMREII
NDKRYGALRTLGERKQAFNEFLLQTKRAAEEERLARQKKLYEDFKRMLEECVELTPSTRWSKTVTMFEDDERFKALEREK
DRRNIFEDHVSELKEKGRVKALEDRKRNIIEYKRFLESCNFIKPNSQWRKVQDRLEVDERCSRLEKIDQLEIFQEYLRDL
EREEEEKKKIQKEELKKVERKHRDEFHGLLDEHIATGELTAKTIWRDYLMKVKDLPVYSAIASNSSGATPKDLFEDAVED
LKKRDHELKSQIKDVLKLRKVNLSAGSTFDEFKVSISEDIGFPLIPDVRLKLVFDDLLERAKEKEEKEARKQTRQTEKLV
DMLRSFKDITASSSWEELKHLVEGSEKCSTIGDESFRKRCFEDYVSLLKEQSNRIKQNKKVPEDVREEHDKGRDKYGREK
DRVRERDSDDHHKKGAAGKYNHDMNEPHGKERRRSGRDSHNRHRERHTSVKENDTDHFKESHKAGGGHKKSRHQRGWVSE
AEVEGKEKRRRKEEAREHTKEEELEDGECGRY*

DNA
ATGGCTAATAACCATCAATATCCTGGCATTCAGCCATTCCAGCATCCTAATGCTAGCTCCATAGATTTACCCCGAGGCTT
TGCTCCACCCATGAACTTTCAGTTTCTTCCTACCATTCAAGCTCCTCAGTCTGAGCAAGTTGCTCGATTGTCTTCTCAGA
ACTTTCAATGTGTTGGCAGAGGTGGCACAGTATTGAGCATTGGATATCCACCTCAATCTTATGCACCTCAGTTATTACAA
TCCATGCACCATTCACATGAAAGACCCAGCCAATTAAATCAGGTGCAAGTGCAACATGTGCCACTTGGACCCCCAACTCT
AATTTCACAGCCAAATGTGTCAATTGCTTCTGGTACCTCCTTGCATCAGCCTTATGTACAAACTCCAGATATTGGTATGC
CTGGCTTTGGTGGCCCTAGGGCACTCTTTTCTTATCCGAGTGCCACATCTTACGAAGGTTCGAGGGTGCCACCTCAAGTC
ACTGGACCAAGCATTCATAGTCAGGCACAACAGAGAGCATCTATCATTCATACTTCTGCAGAATCTTCTATCATGAATCC
GACATTTGAACAACCAAAGGCAGCTTTTTTAAAACCTTTACCTTCTCAAAAGGCTCTAACAGATTGGGTTGAGCATACCT
CTGCGGATGGAAGGAAATATTTTTTCAACAAGAGGACAAAGAAGTCCACTTGGGAGAAGCCTGTTGAGTTGATGACTCTT
TTTGAGAGAGCAGATGCAAGAACTGACTGGAAAGAACATTCAAGTCCTGATGGAAGAAAGTATTACTACAATAAGATTAC
GAAGCAATCAACATGGACAATGCCGGAAGAGATGAAGATTGTGCGTGAACAAGCAGAAATAGCATCTGTTCAAGGGCCTC
ATGCGGAAGGCATTATTGATGCTTCTGAGGTGCTGACTCGTTCTGACACTGCATCGACTGCAGCTCCGACTGGTCTACCA
AGCCAAACTTCAACCTCTGAGGGCGTTGAGAAACTAACTCTTACTTCTGATTTGAAGCAGCCAGCTTCAGTTCCTGGAAG
TTCTTCACCGGTCGAAAATGTTGATCGAGTTCAGATGAGTGCAGATGAAACATCACAATTGTGTGATACTTCAGAAACCG
ATGGTCTTTCTGTCCCTGTGACTGAAACTTCTGCTGCTACATTGGTTGAGAAGGACGAAATTTCAGTCGGGAACAGTGGA
GATTCAGATGACATGTCAACTAAAAACGCAAATCAAGGTAGTGGGAGTGGACCAAAAGAAAGCCAAAAACCTATGGTTGA
AAGTGAAAAGGTTGAGAGCCAAACAGAAGAAAAACAAATTCATCAAGAGAGTTTTTCCTTTAACAATAAATTGGAAGCTG
TGGATGTCTTCAAATCACTTTTGAAATCCGCCAAAGTTGGATCTGACTGGACATGGGAACAGGCCATGAGAGAAATTATT
AATGACAAAAGATACGGTGCTCTGAGGACACTTGGAGAGCGGAAGCAAGCCTTCAATGAGTTCTTACTCCAAACGAAACG
AGCAGCTGAGGAGGAAAGGCTAGCCAGACAGAAAAAACTGTATGAAGATTTTAAAAGGATGTTAGAGGAATGCGTGGAGC
TTACTCCTTCTACTCGGTGGAGTAAGACTGTGACAATGTTTGAAGACGATGAGCGTTTCAAAGCTCTTGAACGAGAAAAA
GACCGTCGTAATATTTTTGAAGATCATGTCAGTGAGCTAAAAGAGAAGGGGCGGGTGAAAGCTCTTGAGGATCGCAAGCG
GAACATAATTGAATACAAAAGATTTTTGGAATCTTGCAATTTCATCAAGCCAAATAGTCAATGGCGCAAAGTTCAGGACC
GCTTAGAAGTGGATGAAAGATGTTCGCGTCTCGAGAAAATTGATCAGCTAGAAATCTTTCAGGAGTATCTGCGTGATCTG
GAAAGAGAAGAAGAGGAGAAAAAGAAGATACAGAAGGAGGAACTCAAAAAAGTAGAGCGAAAGCACCGTGATGAGTTCCA
TGGGCTGTTAGATGAACATATTGCAACAGGAGAGCTTACTGCCAAAACTATATGGCGTGATTATTTAATGAAGGTCAAGG
ATTTACCAGTATATTCAGCAATTGCGTCAAACTCCTCTGGAGCTACTCCAAAAGACTTATTTGAAGATGCTGTTGAGGAT
TTGAAAAAAAGGGACCACGAGCTCAAGTCTCAGATAAAGGATGTATTGAAATTGAGAAAAGTAAATTTATCCGCTGGGTC
AACATTTGATGAGTTCAAGGTTTCTATTTCCGAGGATATTGGTTTTCCTCTTATTCCTGACGTTAGACTAAAGTTAGTCT
TTGATGATTTGCTGGAAAGGGCAAAGGAGAAGGAAGAAAAAGAAGCCAGAAAACAGACACGGCAGACTGAAAAGTTGGTT
GATATGCTTCGCTCCTTCAAGGATATAACTGCCTCTTCATCCTGGGAGGAATTAAAGCATCTTGTTGAGGGTAGTGAAAA
ATGCAGTACTATTGGTGATGAGAGCTTTCGGAAGCGCTGTTTCGAAGATTACGTTTCACTCCTTAAAGAGCAATCAAATA
GGATCAAACAGAACAAGAAGGTACCCGAGGATGTGAGAGAGGAACATGACAAGGGGAGAGATAAATACGGAAGAGAGAAG
GACAGAGTGCGAGAAAGAGACAGTGACGATCATCATAAGAAAGGTGCAGCTGGTAAATACAACCATGATATGAATGAACC
CCATGGAAAAGAACGTAGGAGATCAGGAAGAGATAGCCATAACAGACATAGAGAAAGACATACTAGTGTGAAGGAAAATG
ACACAGACCATTTCAAAGAATCCCATAAAGCTGGCGGTGGGCATAAGAAATCAAGACATCAGCGAGGCTGGGTCTCCGAA
GCAGAGGTTGAGGGCAAGGAAAAGCGGCGTAGAAAAGAAGAAGCGAGGGAGCACACAAAGGAAGAGGAGCTTGAAGATGG
AGAATGTGGTCGGTATTGA