Details for Arabidopsis Locus AT3G19660

Position : Chr3 ( 5`- 6825521 .. 6826006 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19660

Protein [Map View]
MGLQLESLMETIKSKVSLLRKKKKTYIKMDKSSSVRVAIRRKKTRDLIDKTLKVADRPGKRTLF*

DNA
ATGGGATTACAGTTGGAGAGTTTGATGGAGACGATAAAGTCAAAGGTGAGTTTGCTAAGGAAGAAGAAGAAAACTTACAT
CAAAATGGACAAAAGCTCCAGCGTCAGAGTCGCCATCCGTCGTAAGAAGACTAGAGATCTCATCGATAAGACCTTAAAGG
TCGCTGATCGTCCTGGCAAACGAACTCTTTTCTAA