Details for Arabidopsis Locus AT3G19650

Position : Chr3 ( 5`- 6823508 .. 6825261 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19650

Protein [Map View]
MSTRRESRDSDPRRHRSRIDREPSPKRSRRDGKPEAERVLSKKDLDVRDGTDTEKNSRQSLRDAPLELDAHGSRKDSEKK
HSGHHETTKAAPHLSQVPRSRPYSQHDDRRSDGKVDRRPTSVRGSWRSSRDQSNRRAGDDEKSQHRKDEDKSSWRHDRFR
ESDDTQGALSRKRPAFREKKIAEETGNNTDRTRTEDGKDTNLNNRRQNERNWRSNTHSERHERPAMGRDRVWNRDDERGA
GSRQSYQADRDRFNGNGRSGFSGSWTRNEKKWDHDLFDEANKSPAKATEEEQIAKVEALLAS*

DNA
ATGTCGACGAGGCGAGAAAGCAGAGATTCAGACCCTAGACGTCACCGTTCTAGAATCGATCGCGAACCCAGCCCTAAGAG
ATCAAGAAGAGATGGCAAACCTGAAGCTGAACGAGTTCTGAGTAAGAAGGATTTGGATGTTAGAGATGGTACTGACACTG
AGAAAAACTCACGTCAGTCTTTGAGAGATGCTCCATTGGAACTTGATGCTCATGGTTCGAGAAAAGACAGTGAGAAGAAG
CACTCTGGACATCATGAGACCACCAAAGCAGCTCCCCATCTGTCACAAGTACCTCGTTCTAGACCATATTCTCAGCATGA
TGATCGTCGTAGTGATGGAAAAGTTGATAGAAGACCAACTTCTGTGAGAGGATCGTGGAGAAGTTCAAGAGATCAGAGTA
ACCGAAGAGCTGGAGATGATGAGAAGTCACAGCATCGTAAAGACGAAGACAAAAGCTCATGGCGACATGATAGGTTCCGT
GAGAGTGATGACACCCAAGGAGCACTCTCTAGGAAACGACCAGCCTTCAGGGAGAAGAAGATTGCAGAGGAAACTGGGAA
CAACACAGACAGAACAAGAACTGAGGATGGAAAAGACACTAATCTAAACAATCGCAGACAGAACGAGAGGAACTGGAGGA
GCAATACGCATTCAGAAAGACATGAGAGACCAGCAATGGGAAGAGACAGAGTGTGGAACAGAGATGATGAAAGAGGCGCG
GGAAGCAGACAGAGTTATCAAGCTGATAGAGACAGATTCAACGGCAATGGGCGAAGTGGGTTTAGCGGAAGCTGGACAAG
GAATGAGAAGAAATGGGACCATGACTTGTTCGATGAGGCGAACAAGAGTCCAGCTAAAGCCACCGAGGAAGAACAGATAG
CTAAAGTTGAAGCTTTGTTGGCTTCTTGA