Details for Arabidopsis Locus AT3G19640

Position : Chr3 ( 5`- 6820926 .. 6823306 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19640

Protein [Map View]
MRGARPDEFNFSTNPSTPNTGQPTPTYPAGVGGGGGGRKKGVGVRTWLVLNSSGQSEPKEEGKHSIMRRTGLPARDLRIL
DPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLLLNSKDPSVSPFIDELQRRILCHHHATKPQEEQNSGGEPHTRVDPA
QGEAGTEQSSGDQGSEAKKDAKQSLENQDGSKVLPFEFVALEACLEAASSSLEHEALRLELEAHPALDKLTSKISTLNLE
RVRQIKSRLVAITGRVQKVRDELEHLLDDDEDMAEMYLTEKLAQKLEDSSNSSMNESDTFEVDLPQGDEDDRLPPEFASE
ANRDGRYLQANDAHELLMSTQSALSRNSRGTHTSSTRSAMTNKLDVEELEMLLEAYFVQIDGILNKLSTLREYVDDTEDY
INIMLDDKQNHLLQMGVMLTTATLVMSAFIAVAGVFGMNITIELFTDNKHGPSRFIWTVIGGSIGSICLYVGAIGWCKYK
RLLE*

DNA
ATGAGAGGAGCTAGACCCGATGAATTCAATTTTAGTACGAATCCATCAACGCCAAACACTGGTCAGCCGACACCGACGTA
CCCCGCCGGTGTTGGCGGCGGCGGCGGTGGAAGGAAAAAAGGCGTTGGCGTGAGGACGTGGTTGGTACTTAACTCGTCAG
GGCAATCGGAGCCGAAGGAAGAAGGGAAACACTCCATCATGCGGCGAACGGGATTACCGGCGCGTGATCTTAGGATTCTC
GATCCACTGTTGTCGTATCCATCTACTGTTTTAGGTAGAGAGAGAGCGATTGTCATCAATTTGGAGCATATCAAGGCAAT
CATCACTGCTCAAGAAGTTTTGTTGCTTAATTCCAAGGATCCTTCGGTCTCACCCTTTATTGATGAGTTGCAGAGGCGGA
TTCTCTGTCACCATCACGCCACTAAACCTCAGGAGGAGCAGAACTCTGGGGGAGAGCCTCATACGAGGGTAGATCCTGCC
CAAGGAGAAGCTGGAACGGAACAATCTTCTGGGGATCAAGGGAGTGAAGCCAAGAAGGATGCGAAGCAAAGTCTTGAGAA
TCAAGATGGATCGAAGGTTCTTCCATTTGAGTTTGTTGCTCTGGAAGCCTGTCTTGAAGCTGCATCAAGCAGTTTGGAAC
ATGAGGCCTTAAGATTGGAGTTAGAGGCTCATCCAGCCCTGGACAAGCTTACTTCCAAGATCAGTACCCTTAATTTGGAG
CGGGTTCGACAGATTAAAAGCAGGCTGGTTGCAATAACTGGACGTGTTCAGAAGGTGAGGGATGAGCTAGAACATCTGCT
AGACGATGATGAAGATATGGCTGAGATGTATCTTACAGAGAAGTTAGCTCAGAAACTTGAGGATTCGTCAAATTCCTCTA
TGAATGAGAGTGATACCTTCGAGGTTGATCTTCCTCAAGGAGATGAGGATGACAGGCTTCCTCCCGAATTTGCATCAGAG
GCTAACAGAGATGGAAGGTATCTTCAAGCAAATGATGCTCACGAGCTTCTTATGAGTACTCAAAGTGCACTTAGCAGAAA
TAGCCGTGGGACTCACACAAGCTCAACCCGGAGTGCCATGACCAACAAATTAGATGTGGAAGAGCTTGAAATGCTTTTGG
AAGCATATTTCGTGCAGATCGATGGTATACTGAACAAACTATCAACACTAAGGGAATATGTGGATGACACGGAGGACTAC
ATCAACATAATGCTAGATGACAAGCAGAATCATCTTCTGCAGATGGGTGTGATGCTAACAACAGCTACTCTGGTGATGAG
CGCCTTTATCGCAGTTGCTGGTGTATTTGGTATGAATATAACCATAGAGTTGTTCACGGATAATAAACATGGTCCAAGTA
GATTCATTTGGACTGTGATTGGAGGTTCTATCGGCAGTATATGCCTCTACGTTGGTGCCATCGGGTGGTGCAAGTACAAG
CGCCTTCTTGAATGA